KEGG   Escherichia coli O157 H7 Sakai (EHEC): ECs2846Help
Entry
ECs2846           CDS       T00048                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ecs  Escherichia coli O157:H7 Sakai (EHEC)
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ecs00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ECs2846
   00052 Galactose metabolism
    ECs2846
   00500 Starch and sucrose metabolism
    ECs2846
   00520 Amino sugar and nucleotide sugar metabolism
    ECs2846
Enzymes [BR:ecs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     ECs2846
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2787593..2788486)
Genome map
AA seq 297 aa AA seqDB search
MTNLKAVIPVAGLGMHMLPATKAIPKEMLPIVDKPMIQYIVDEIVAAGIKEILLVTHASK
NAVENHFDTSYELESLLEQRVKRQLLAEVQSICPPGVTIMNVRQGEPLGLGHSILCARPA
IGDNPFVVVLPDVVIDDASADPLRYNLAAMIARFNETGRSQVLAKRMPGDLSEYSVIQTK
EPLDREGKVSRIVEFIEKPDQPQTLDSDIMAVGRYVLSADIWPELERTQPGAWGRIQLTD
AIAELAKKQSVDAMLMTGDSYDCGKKMGYMQAFVKYGLRNLKEGAKFRKGIEKLLSE
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatttaaaagcagttataccggtagcaggtcttgggatgcatatgttgcctgcc
actaaggcgattcccaaagagatgctaccgatcgtcgacaagccaatgattcagtacatt
gttgacgagattgtggctgcagggatcaaagaaatcctcctggtaactcacgcgtccaag
aacgcagtcgaaaaccacttcgacacctcttatgaattagaatctctccttgaacagcgc
gtgaagcgtcaactactggcggaagtacaatctatctgtccgccgggcgtgaccattatg
aacgtgcgtcagggtgaacctttaggtttaggccactccattttatgtgcgcgacctgcc
attggtgacaatccatttgtcgtggtgctgccagacgttgtgatcgacgacgccagcgcc
gacccgctacgctacaaccttgctgccatgattgcgcgcttcaatgaaacgggacgcagc
caggtgctggcaaaacgtatgccgggcgacctctctgaatactccgtcatccagaccaaa
gaaccgctggatcgtgaaggcaaagtcagccgcattgttgaatttatcgaaaagccggat
cagccgcagacgctggactcagacatcatggccgttggtcgatatgtgctttctgccgat
atttggccggaactggaacgtactcagcctggtgcatggggacgtattcagctgactgat
gccattgctgagctggcaaaaaaacaatccgttgatgcaatgctgatgactggcgacagt
tacgactgcggtaaaaaaatgggctatatgcaggcgtttgtgaagtatggactacgcaac
ttgaaagaaggggcgaagttccgcaaaggtatcgagaagctgttaagcgaataa

DBGET integrated database retrieval system