KEGG   Escherichia coli O157 H7 Sakai (EHEC): ECs3224Help
Entry
ECs3224           CDS       T00048                                 

Gene name
fadJ
Definition
(RefSeq) multifunctional fatty acid oxidation complex subunit alpha
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
ecs  Escherichia coli O157:H7 Sakai (EHEC)
Pathway
ecs00071  Fatty acid degradation
ecs00280  Valine, leucine and isoleucine degradation
ecs00281  Geraniol degradation
ecs00310  Lysine degradation
ecs00362  Benzoate degradation
ecs00380  Tryptophan metabolism
ecs00410  beta-Alanine metabolism
ecs00640  Propanoate metabolism
ecs00650  Butanoate metabolism
ecs00903  Limonene and pinene degradation
ecs00930  Caprolactam degradation
ecs01040  Biosynthesis of unsaturated fatty acids
ecs01100  Metabolic pathways
ecs01110  Biosynthesis of secondary metabolites
ecs01120  Microbial metabolism in diverse environments
ecs01130  Biosynthesis of antibiotics
ecs01200  Carbon metabolism
ecs01212  Fatty acid metabolism
Module
ecs_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ecs00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    ECs3224 (fadJ)
   00650 Butanoate metabolism
    ECs3224 (fadJ)
  Lipid metabolism
   00071 Fatty acid degradation
    ECs3224 (fadJ)
   01040 Biosynthesis of unsaturated fatty acids
    ECs3224 (fadJ)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ECs3224 (fadJ)
   00310 Lysine degradation
    ECs3224 (fadJ)
   00380 Tryptophan metabolism
    ECs3224 (fadJ)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ECs3224 (fadJ)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    ECs3224 (fadJ)
   00281 Geraniol degradation
    ECs3224 (fadJ)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ECs3224 (fadJ)
   00930 Caprolactam degradation
    ECs3224 (fadJ)
Enzymes [BR:ecs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     ECs3224 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     ECs3224 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     ECs3224 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-GeneID: 915679
NCBI-ProteinID: NP_311251
UniProt: Q8XCP2
Position
complement(3183430..3185574)
Genome map
AA seq 714 aa AA seqDB search
MEMTSAFTLNVRLDNIAIITIDVPGEKMNTLKAEFASQVRAIIKQLRENKELRGVVFVSA
KPDNFIAGADINMIGNCKTAQEAEALARQGQQLMAEIHALPIPVIAAIHGACLGGGLELA
LACHGRVCTDDPKTVLGLPEVQLGLLPGSGGTQRLPRLIGVSTALEMILTGKQLRAKQAL
KLGLVDDVVPHSILLEAAVELAKKDRPSSRPLPVRERILAGPLGRAQLFKMVGKKTEHKT
QGNYPATERILEVVETGLAQGTSSGYDAEARAFGELAMTPQSQALRSIFFASTEVKKDPG
SDAPPAPLNSVGILGGGLMGGGIAYVTACKAGIPVRIKDINPQGINHALKYSWDQLEGKV
RRRHLKASERDKQLALISGTTDYRGFAHRDLIIEAVFENLELKQQMVAEVEQNCAAHTIF
ASNTSSLPIGDIAAHATRPEQVIGLHFFSPVEKMPLVEIIPHAGTSAQTIATTVKLAKKQ
GKTPIVVRDKAGFYVNRILAPYINEAIRMLTEGERVAHIDAALVKFGFPVGPIQLLDEVG
IDTGTKIIPVLEAAYGERFSAPANVVSSILNDDRKGRKNGRGFYLYGQKGRKSKKQVDPA
IYPLIGAQGQGRLSAPQVAERCVMLMLNEAVRCVDEQVIRSVRDGDIGAVFGIGFPPFLG
GPFRYIDSLGAGEVVAIMQRLATQYGSRFTPCERLVEMGARGESFWKTTATDLQ
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atggaaatgacatcagcgtttactcttaatgttcgtctggacaacattgctatcatcacc
atcgacgtaccgggtgagaaaatgaataccctgaaggcggagtttgcctcgcaggtgcgc
gccattattaagcaactccgtgaaaacaaagagttgcgaggcgtggtgtttgtctccgct
aaaccggacaacttcattgctggcgcagacatcaacatgatcggcaattgcaaaacggcg
caagaagcggaagctctggcgcggcagggccaacagttgatggcggagattcatgctttg
cccattccggttatcgcggctattcatggcgcttgcctgggtggtgggctggagttggcg
ctggcgtgccacggtcgcgtttgtactgacgatcctaaaacggtgctcggtttgcctgaa
gtacaacttggattgttacccggttcaggcggcacccagcgtttaccgcgtctgataggc
gtcagcacagcattagagatgatcctcaccggaaaacaacttcgggcgaaacaggcatta
aagctggggctggtggatgatgttgttccgcactccattctgctggaagccgctgttgag
ctggcaaagaaggatcgcccatcttcccgccctctacctgtacgcgagcgtattctggcg
gggccgttaggtcgtgcgcagctgttcaaaatggtcggcaagaaaacagaacacaaaact
caaggcaattatccggcgacagaacgcatcctggaggttgttgaaacgggattagcgcag
ggcaccagcagtggctatgacgctgaagcacgggcgtttggcgaactggcgatgacgcca
caatcgcaagctttgcgtagtatcttttttgccagtacggaagtgaagaaagatcccggc
agtgatgcgccgcctgcgccattaaacagcgtggggattttaggtggtggcttgatgggc
ggcggtattgcttatgtcactgcttgtaaagcggggattccggtcagaattaaagatatc
aacccgcagggcataaatcatgcgctgaagtacagttgggatcagctggagggcaaagtt
cgccgtcgtcatctcaaagccagcgaacgtgacaaacagctggcattaatctccggaacg
acggactatcgcggctttgcccatcgcgatctgattattgaagcggtgtttgaaaatctc
gaattgaaacaacagatggtggcggaagttgagcaaaattgcgccgctcataccatcttt
gcttcgaatacgtcatctttaccgattggtgatatcgccgctcacgccacgcgacctgag
caagttatcggcctgcatttcttcagtccggtggaaaaaatgccgctggtggagattatt
cctcatgcgggtacatcagcacaaaccatcgccactacggtaaaactggcgaaaaaacag
ggcaaaacgcccattgtcgtgcgtgacaaagccgggttttacgtcaatcgcatcttagcg
ccttacattaatgaagctatccgcatgctgaccgaaggtgaacgggtagcgcacattgat
gccgcgctagtgaaatttggttttccggtaggtccaatccaacttttggatgaggtagga
atcgacaccgggactaaaattattcctgtactggaagccgcttatggagaacgttttagc
gcgcctgcaaatgttgtttcttcaattttgaacgacgatcgcaaaggcagaaaaaatggt
cgaggtttctatctttatggtcagaaagggcgtaaaagcaaaaaacaggtcgatcctgcc
atttacccgctcattggcgcacaagggcaggggcgactctccgcaccgcaggttgctgaa
cggtgtgtgatgttgatgctgaatgaagctgtacgttgtgttgatgagcaggttatccgt
agcgtgcgtgacggggatattggtgcggtatttggcattggttttccgccatttctcggt
ggaccgtttcgctatatcgattctctcggcgcgggcgaagtggttgcaataatgcaacga
ctggccacgcagtatggttcacgttttaccccttgcgagcgtttagtcgagatgggtgcg
cgtggggaaagtttttggaaaacaactgcaactgacctgcaataa

DBGET integrated database retrieval system