KEGG   Escherichia coli O157 H7 Sakai (EHEC): ECs3572Help
Entry
ECs3572           CDS       T00048                                 

Definition
cryptic 6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
ecs  Escherichia coli O157:H7 Sakai (EHEC)
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ecs00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3564709..3566133
Genome map
AA seq 474 aa AA seqDB search
MSVFPEGFLWGGALAANQSEGAFREGGKGLTTVDMIPHGEHRMAVKLGLEKRFQLRDDEF
YPSHEATGFYHRYKEDIALMAEMGFKVFRTSIAWSRPFPQGDELTPNQQGIAFYRSVFEE
CKKYGIEPLVTLCHFDVPMQLVTEYGSWRNRKLVEFFSRYARTCFEAFDGLVKYWLTFNE
INIMLHSPFSGAGLVFEEGENQDQVKYQAAHHQLVASALATKIAHEVNPQNQVGCMLAGG
NFYPYSCKPEDVWAALEKDRENLFFIDVQARGAYPAYSARVFREKGVTIDKAPGDDEILK
NTVDFVSFSYYASRCASAEMNTNNSSAANVVKSLRNPYLQVSDWGWGIDPLGLRITMNMM
YDRYQKPLFLVENGLGAKDELAANGEINDDYRISYLREHIRAMGEAIADGIPLMGYTTWG
CIDLVSASTGEMSKRYGFVFVDRDDAGNGTLTRTRKKSFWWYKKVIASNGEDLE
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtatttccagaaggttttttatggggcggcgcgcttgccgccaaccagtctgaa
ggtgcgttccgtgaaggtggcaaaggactgacaacggtcgatatgatcccacacggcgag
catcgaatggcggtgaaactggggctggaaaaacgttttcagttgcgcgatgacgagttt
tatcccagccatgaggcgacgggtttttatcatcgttataaagaagatatcgccctgatg
gcagagatgggattcaaagtgttccgtacctcaattgcctggagccgccccttcccgcag
ggtgatgaactgacgcccaaccagcagggcattgctttttaccgttctgtctttgaagag
tgtaaaaagtacggtatcgaaccgctggtcacattgtgccacttcgatgtgccgatgcag
ctggtcaccgaatatggctcctggcgtaaccgcaagctggtggagtttttcagccgctac
gccaggacctgctttgaagcatttgatggtctggtgaaatactggctaaccttcaatgaa
atcaacattatgttgcatagcccgttctccggcgcggggctggtgtttgaagaaggtgaa
aatcaggatcaggtgaaatatcaggccgcgcatcaccagctggttgccagtgcgctagcc
accaaaatcgcccatgaggttaacccgcaaaatcaggtgggctgtatgctggcgggcggt
aacttctacccttacagttgcaagccggaagatgtctgggcggcgctggagaaagatcgg
gaaaacctgttttttatcgatgtgcaggcgcggggcgcgtatccggcttactctgctcgc
gtattccgcgaaaaaggggtaaccatcgacaaagcaccgggcgatgatgagatcctgaaa
aacaccgtcgattttgtctctttcagctattacgcctcgcgctgcgcctcggcggagatg
aacaccaacaatagcagtgcggcgaacgtagtgaaatcgctgcgtaacccgtatctacag
gtgagcgactggggctggggaattgatccactcggtctgcgtatcaccatgaacatgatg
tacgaccgctatcagaagccgctgtttctggtggaaaacggcctcggcgcaaaagatgaa
cttgctgccaatggcgagattaacgatgactatcgcatcagctatttacgcgaacatatc
cgcgcaatgggcgaagcgattgcagatggcattccgctgatgggctacaccacatggggc
tgtattgatttagtttccgcctctacgggtgaaatgagcaaacgctacggttttgtcttt
gttgaccgtgacgacgcaggcaacggcacgctgacgcgcacacgtaagaaatcgttctgg
tggtataaaaaagtgattgccagtaatggggaagatttagagtag

DBGET integrated database retrieval system