KEGG   Escherichia coli O157 H7 Sakai (EHEC): ECs3620Help
Entry
ECs3620           CDS       T00048                                 

Definition
6-pyruvoyl tetrahydrobiopterin synthase
Orthology
K01737  
6-pyruvoyltetrahydropterin/6-carboxytetrahydropterin synthase [EC:4.2.3.12 4.1.2.50]
Organism
ecs  Escherichia coli O157:H7 Sakai (EHEC)
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ecs00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
3612332..3612697
Genome map
AA seq 121 aa AA seqDB search
MMSTTLFKDFTFEAAHRLPHVPEGHKCGRLHGHSFMVRLEITGEVDPHTGWIIDFAELKA
AFKPTYERLDHHYLNDIPGLENPTSEVLAKWIWDQVKPVVPLLSAVMVKETCTAGCIYRG
E
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atgatgtccaccacgttatttaaagatttcaccttcgaagccgctcaccgcttaccacac
gtcccggaagggcataaatgtggtcgcctgcacgggcattcctttatggtgcgactggaa
attaccggggaagtcgatccgcatacgggctggattatcgatttcgctgaactaaaagcg
gcgtttaagccaacttatgagcgcctcgatcaccattatctcaatgatattccaggtctg
gaaaacccaactagcgaagttttagcaaaatggatttgggatcaggttaaacccgttgtg
ccgctgttaagtgcggtgatggtaaaagaaacctgcaccgctggttgtatctatcgcggc
gaatga

DBGET integrated database retrieval system