KEGG   Escherichia coli O157 H7 Sakai (EHEC): ECs3773Help
Entry
ECs3773           CDS       T00048                                 

Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
ecs  Escherichia coli O157:H7 Sakai (EHEC)
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:ecs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECs3773
Enzymes [BR:ecs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     ECs3773
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3781692..3783131
Genome map
AA seq 479 aa AA seqDB search
MIVKKLTLPKDFLWGGAVAAHQVEGGWNKGGKGPSICDVLTGGAHGVPREITKEVLPGKY
YPNHEAVDFYGHYKEDIKLFAEMGFKCFRTSIAWTRIFPKGDEAQPNEEGLKFYDSLFDE
LLKYNIEPVITLSHFEMPLHLVQQYGSWTNRKVVDFFVRFAEVVFERYKHKVKYWMTFNE
INNQRNWRAPLFGYCCSGVVYTEHENPEETMYQVLHHQFVASALAVKAARRINLEMKVGC
MLAMVPLYPYSCNPDDVMFAQESMRERYVFTDVQLRGYYPSYVLNEWERRGFNIKMEDSD
LDVLREGTCDYLGFSYYMTNAVKAEGGTGDAISGFEGSVPNPYVKASDWGWQIDPVGLRY
ALCELYERYQKPLFIVENGFGAYDKVEEDGSINDDYRIDYLRAHIEEMKKAVTYDGVDLM
GYTPWGCIDCVSFTTGQYSKRYGFIYVNKHDDGTGDMSRSRKKSFNWYKEVIASNGENL
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgatagtgaaaaaactcaccttaccgaaagatttcttatggggcggcgcagttgccgct
catcaggtcgaaggcggctggaacaaaggcggaaaagggccgagcatttgtgacgttctg
accggtggcgcacacggcgtgccgcgcgaaataaccaaagaagtcttgccaggcaaatac
tatccaaaccatgaagccgttgatttttatggtcactataaggaagacatcaagctattt
gccgaaatgggcttcaaatgttttcgtacatccattgcctggacgcgcatttttccaaaa
ggcgatgaagctcagccaaacgaagaagggctgaagttctacgactctctgttcgatgaa
ctgctgaaatacaacatcgaaccggtgatcaccctctcccactttgaaatgccgctgcat
ctggtgcagcaatacggtagctggaccaaccgtaaagtggttgatttctttgtacgtttc
gcggaagtggtatttgaacgctataagcacaaagtcaaatactggatgaccttcaacgaa
attaacaaccagcgtaactggcgtgcaccgctgttcggttactgctgctccggcgtggtg
tataccgagcatgaaaacccggaagagacgatgtatcaggtgctgcatcaccagtttgtc
gccagcgccctggcagtgaaagccgcgcgtcgcattaacctggagatgaaagtcggctgt
atgctggcgatggtgccgctctatccctactcatgtaacccggacgatgtgatgttcgct
caggagtcgatgcgcgaacgctacgtctttaccgatgtgcagctacgcggctattacccg
tcgtatgtgttgaacgagtgggagcgtcgcggatttaacatcaaaatggaagatagcgat
ctcgatgtactgcgcgaaggcacctgcgattatcttggtttcagctattacatgaccaac
gcagtgaaggccgaaggcggcaccggcgatgcgatctctggttttgaaggcagcgtacca
aacccgtatgttaaagcatctgactggggctggcagattgatccggtgggtctgcgttac
gcactttgcgaactgtatgagcgttaccagaagccgctgtttattgtcgaaaacggtttt
ggcgcttacgacaaagtggaagaagatggcagcatcaacgacgactaccgcattgactac
ctgcgcgcccatattgaagagatgaaaaaagcagtaacttacgatggcgtggatctgatg
ggctacacaccgtggggctgcatcgactgcgtgtcgttcactaccgggcagtacagcaaa
cgctacggctttatctatgtgaataaacatgacgacggtactggcgatatgtcgcgttca
cgtaagaagagctttaactggtacaaagaagtgattgccagcaacggcgagaatctgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system