KEGG   Escherichia coli O157 H7 Sakai (EHEC): ECs4263Help
Entry
ECs4263           CDS       T00048                                 

Definition
(RefSeq) RNA 3'-terminal-phosphate cyclase
  KO
K01974  
RNA 3'-terminal phosphate cyclase (ATP) [EC:6.5.1.4]
Organism
ecs  Escherichia coli O157:H7 Sakai (EHEC)
Brite
Enzymes [BR:ecs01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.4  RNA 3'-terminal-phosphate cyclase (ATP)
     ECs4263
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(4268769..4269797)
Genome map
AA seq 342 aa AA seqDB search
MKRMIALDGAQGEGGGQIMRSALSLSMITGQPFTITGIRAGRAKPGLLRQHLTAVKAATE
ICGATVEGAELGSQRLVFRPGTVRGGDYRFAIGSAGSCTLVLQTVLPALWFADGPSRVEV
SGGTDNPSAPPADFIRRVLEPLLAKIGIHQQTTLLRHGFYPAGGGVVATEVSPVASFNTL
QLGERGNIVQMRGEVLLAGVPRHVAEREIATLAASFSLHEQNIHNLPRDQGPGNTVSLEV
ESENITERFFVVGEKRVSAEVVAAQLVKEVKRYLASPAAVGEYLADQLVLPMALAGAGQF
TVAHPSCHLLTNIAVVERFLPVRFTLAETDGVTRVMITKLTD
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaggatgattgcgctggatggcgcacagggcgaaggcggcgggcagatcatgcgc
tcggcgctgagtctgtcgatgataaccggccagccatttaccatcaccggcattcgtgcc
gggcgggcaaaaccgggactgttgcgccagcatctgacggcggtaaaggcggcgacggaa
atttgcggggcgacggtggaaggcgcggagctggggtcgcagcgtctggtcttccggccc
ggcaccgtgcgtggcggcgattatcgctttgctatcggtagcgcaggaagttgtacgctg
gtgctgcaaacggtgctgcccgcgctgtggtttgccgatggaccttcgcgtgttgaagtg
agcggcggtaccgataacccgtcggccccgcctgcggattttatccgccgggtgttggag
ccgctgctggcgaaaataggaattcatcagcaaaccacgctgttacgtcacggtttttat
cctgccggaggcggcgtggtggcaacggaagtctcgccggtggcatcgtttaacaccttg
caacttggcgagcgcgggaacattgtgcagatgcgtggagaggtgttattagctggcgtg
ccgcggcatgtcgctgagcgtgaaatcgctacgctggcggcaagtttttccctgcatgag
cagaatattcataacctgccgcgcgaccaggggccgggtaataccgtctcgcttgaagtc
gaaagtgaaaatatcaccgaacgcttttttgtcgtcggtgaaaagcgcgtcagtgccgag
gtggttgcggcacagttggtgaaagaggtgaaacgctacctggcaagcccggcggcagtg
ggggaatatcttgctgaccagctagtgttgccaatggcgctggcgggcgcgggacaattt
acggtcgcccatccctcatgccatctgctgaccaatatcgccgtggtggagcgtttcttg
ccggtgcggtttactctggctgaaacagatggcgtaacgcgggtgatgataaccaaactc
actgattga

DBGET integrated database retrieval system