KEGG   Escherichia coli O157 H7 Sakai (EHEC): ECs4263Help
Entry
ECs4263           CDS       T00048                                 

Definition
RNA 3'-terminal-phosphate cyclase (EC:6.5.1.4)
Orthology
K01974  
RNA 3'-terminal phosphate cyclase (ATP) [EC:6.5.1.4]
Organism
ecs  Escherichia coli O157:H7 Sakai (EHEC)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4268769..4269800)
Genome map
AA seq 343 aa AA seqDB search
MMKRMIALDGAQGEGGGQIMRSALSLSMITGQPFTITGIRAGRAKPGLLRQHLTAVKAAT
EICGATVEGAELGSQRLVFRPGTVRGGDYRFAIGSAGSCTLVLQTVLPALWFADGPSRVE
VSGGTDNPSAPPADFIRRVLEPLLAKIGIHQQTTLLRHGFYPAGGGVVATEVSPVASFNT
LQLGERGNIVQMRGEVLLAGVPRHVAEREIATLAASFSLHEQNIHNLPRDQGPGNTVSLE
VESENITERFFVVGEKRVSAEVVAAQLVKEVKRYLASPAAVGEYLADQLVLPMALAGAGQ
FTVAHPSCHLLTNIAVVERFLPVRFTLAETDGVTRVMITKLTD
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaaaggatgattgcgctggatggcgcacagggcgaaggcggcgggcagatcatg
cgctcggcgctgagtctgtcgatgataaccggccagccatttaccatcaccggcattcgt
gccgggcgggcaaaaccgggactgttgcgccagcatctgacggcggtaaaggcggcgacg
gaaatttgcggggcgacggtggaaggcgcggagctggggtcgcagcgtctggtcttccgg
cccggcaccgtgcgtggcggcgattatcgctttgctatcggtagcgcaggaagttgtacg
ctggtgctgcaaacggtgctgcccgcgctgtggtttgccgatggaccttcgcgtgttgaa
gtgagcggcggtaccgataacccgtcggccccgcctgcggattttatccgccgggtgttg
gagccgctgctggcgaaaataggaattcatcagcaaaccacgctgttacgtcacggtttt
tatcctgccggaggcggcgtggtggcaacggaagtctcgccggtggcatcgtttaacacc
ttgcaacttggcgagcgcgggaacattgtgcagatgcgtggagaggtgttattagctggc
gtgccgcggcatgtcgctgagcgtgaaatcgctacgctggcggcaagtttttccctgcat
gagcagaatattcataacctgccgcgcgaccaggggccgggtaataccgtctcgcttgaa
gtcgaaagtgaaaatatcaccgaacgcttttttgtcgtcggtgaaaagcgcgtcagtgcc
gaggtggttgcggcacagttggtgaaagaggtgaaacgctacctggcaagcccggcggca
gtgggggaatatcttgctgaccagctagtgttgccaatggcgctggcgggcgcgggacaa
tttacggtcgcccatccctcatgccatctgctgaccaatatcgccgtggtggagcgtttc
ttgccggtgcggtttactctggctgaaacagatggcgtaacgcgggtgatgataaccaaa
ctcactgattga

DBGET integrated database retrieval system