KEGG   Escherichia coli O157 H7 Sakai (EHEC): ECs4277Help
Entry
ECs4277           CDS       T00048                                 

Definition
glycogen branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
ecs  Escherichia coli O157:H7 Sakai (EHEC)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:ecs00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ECs4277
Enzymes [BR:ecs01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     ECs4277
Exosome [BR:ecs04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ECs4277
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4287116..4289302)
Genome map
AA seq 728 aa AA seqDB search
MSDRIDRDVINALIAGHFADPFSVLGMHKTTAGLEVRALLPDATDVWVIEPKTGRKLAKL
ECLDSRGFFSGVIPRRKNFFRYQLAVVWHGQQNLIDDPYRFGPLIQEMDAWLLSEGTHLR
PYETLGAHADTMDGVTGTRFSVWAPNARRVSVVGQFNYWDGRRHPMRLRKESGIWELFIP
GAHNGQLYKYEMIDANGNLRLKSDPYAFEAQMRPETASLICGLPEKVVQTEERKKANQFD
APISIYEVHLGSWRRHTDNNFWLSYRELADQLVPYAKWMGFTHLELLPLNEHPFDGSWGY
QPTGLYAPTRRFGTRDDFRYFIDAAHAAGLNVILDWVPGHFPTDDFALAEFDGTNLYEHS
DPREGYHQDWNTLIYNYGRREVSNFLVGNALYWIERFGIDALRVDAVASMIYRDYSRKEG
EWIPNEFGGRENLEAIEFLRNTNRILGEQVSGAVTMAEESTDFPGVSRPQDMGGLGFWYK
WNLGWMHDTLDYMKLDPIYRQYHHDKLTFGMLYNYTENFVLPLSHDEVVHGKKSILDRMP
GDAWQKFANLRAYYGWMWAFPGKKLLFMGNEFAQGREWNHDASLDWHLLEGGDNWHHGVQ
RLVRDLNLTYRHHKAMHELDFDPYGFEWLVVDDKERSVLIFVRRDKEGNEIIVASNFTPV
PRHDYRFGINQPGKWREILNTDSMHYHGSNAGNGGTVHSDEIASHGRQHSLSLTLPPLAT
IWLVREAE
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgtccgatcgtatcgatagagacgtgattaacgcgctaattgcaggccattttgcggat
cctttttccgtactgggaatgcataaaaccaccgcgggactggaagtccgtgccctttta
cccgacgctaccgatgtgtgggtgattgaaccgaaaaccgggcgcaaactcgcaaaactg
gagtgtctcgactcacggggattctttagtggcgtcattccgcgacgtaagaattttttc
cgctatcagttggctgttgtctggcatgggcagcaaaacctgattgatgatccttaccgt
tttggtccgctaatccaggaaatggatgcctggctattatctgaaggtactcacctgcgc
ccgtatgaaactttaggcgcgcatgcagatactatggatggcgtcacaggtacgcgtttc
tctgtctgggctccaaacgcccgtcgggtctcggtggttgggcaattcaactactgggac
ggtcgccgtcacccgatgcgcctgcgtaaagagagcggcatctgggaactgtttatccct
ggggcgcataacggtcagctctataaatacgagatgattgatgccaatggcaacttgcgt
ctgaagtccgacccttatgccttcgaagcgcaaatgcgcccggaaaccgcgtctcttatt
tgcgggctgccggaaaaggttgtacagactgaagagcgcaaaaaagcgaatcagtttgat
gcgccaatctctatttatgaagttcacctgggctcctggcgtcgccacaccgacaacaat
ttctggttgagctaccgcgagctggccgatcaactggtgccttatgctaaatggatgggc
tttacccacctcgaactactgccccttaacgagcatcccttcgatggcagttggggttat
cagccaaccggcctgtatgcaccaacccgccgttttggtactcgcgacgacttccgttat
ttcattgatgctgcacacgcagctggtctgaacgtgattctcgactgggtgccaggccac
ttcccgactgatgactttgcgcttgccgaatttgatggtacgaacttgtatgaacacagc
gatccgcgcgaaggctatcatcaggactggaacacgctgatttacaactatggtcgccgt
gaagtcagtaacttcctcgtcggtaacgcgctttactggattgaacgttttggtattgat
gcgctgcgcgtcgatgcggtggcgtcgatgatttatcgtgactacagccgtaaagagggg
gagtggatcccgaacgaatttggcgggcgcgagaatcttgaagcgattgaattcttgcgt
aataccaaccgtattcttggtgagcaggtttccggtgcggtgacaatggctgaggagtct
accgatttccctggcgtttctcgtccgcaggatatgggcggtctgggcttctggtacaag
tggaacctcggctggatgcatgacaccctggactacatgaagctcgacccgatttatcgt
cagtatcatcacgataaactgaccttcgggatgctctacaactacactgaaaacttcgtc
ctgccgttgtcgcatgatgaagtggtccacggtaaaaaatcgattctcgaccgcatgccg
ggcgacgcatggcagaaattcgctaacctgcgcgcttactatggctggatgtgggcattt
ccgggcaagaaactgctgttcatggggaacgaatttgcccagggccgcgagtggaaccat
gacgccagcctcgactggcatctgttggaaggcggcgataactggcaccacggtgtccag
cgtctggtgcgcgatctgaacctcacctaccgccaccataaagcgatgcatgaactggat
tttgacccgtacggctttgaatggctggtggtggatgacaaagaacgctcggtgctgatc
tttgtgcgtcgcgataaagagggtaacgaaatcatcgttgccagtaactttacgccggtg
ccgcgtcatgattatcgcttcggcattaatcagccaggcaaatggcgtgagatcctcaat
accgattccatgcactatcacggcagtaatgcaggtaatggcggcacggtacacagcgat
gagattgccagccacggtcgtcagcattcactaagcctgacgctaccaccgctggccact
atctggctggttcgggaggcagaatga

DBGET integrated database retrieval system