KEGG   Escherichia coli O157 H7 Sakai (EHEC): ECs4671Help
Entry
ECs4671           CDS       T00048                                 

Definition
(RefSeq) glucosamine--fructose-6-phosphate aminotransferase (EC:2.6.1.16)
  KO
K00820  
glucosamine--fructose-6-phosphate aminotransferase (isomerizing) [EC:2.6.1.16]
Organism
ecs  Escherichia coli O157:H7 Sakai (EHEC)
Pathway
Alanine, aspartate and glutamate metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of antibiotics
Insulin resistance
Brite
KEGG Orthology (KO) [BR:ecs00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    ECs4671
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ECs4671
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    ECs4671
Enzymes [BR:ecs01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.16  glutamine---fructose-6-phosphate transaminase (isomerizing)
     ECs4671
Peptidases [BR:ecs01002]
 Cysteine Peptidases
  Family C44
   ECs4671
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(4705284..4707113)
Genome map
AA seq 609 aa AA seqDB search
MCGIVGAIAQRDVAEILLEGLRRLEYRGYDSAGLAVVDAEGHMTRLRRLGKVQMLAQAAE
EHPLHGGTGIAHTRWATHGEPSEVNAHPHVSEHIVVVHNGIIENHEPLREELKARGYTFV
SETDTEVIAHLVNWELKQGGTLREAVLRAIPQLRGAYGTVIMDSRHPDTLLAARSGSPLV
IGLGMGENFIASDQLALLPVTRRFIFLEEGDIAEITRRSVNIFDKTGAEVKRQDIESNLQ
YDAGDKGIYRHYMQKEIYEQPNAIKNTLTGRISHGQVDLSELGPNADELLSKVEHIQILA
CGTSYNSGMVSRYWFESLAGIPCDVEIASEFRYRKSAVRRNSLMITLSQSGETADTLAGL
RLSKELGYLGSLAICNVPGSSLVRESDLALMTNAGTEIGVASTKAFTTQLTVLLMLVAKL
SRLKGLDASIEHDIVHGLQALPSRIEQMLSQDKRIEALAEDFSDKHHALFLGRGDQYPIA
LEGALKLKEISYIHAEAYAAGELKHGPLALIDADMPVIVVAPNNELLEKLKSNIEEVRAR
GGQLYVFAEQDAGFVSSDNMHIIEMPNVEEVIAPIFYTVPLQLLAYHVALIKGTDVDQPR
NLAKSVTVE
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaattgttggcgcgatcgcgcaacgtgatgtagcagaaatccttcttgaaggt
ttacgtcgtctggaataccgcggatatgactctgccggtctggccgttgttgatgcggaa
ggtcatatgacccgcctgcgtcgcctcggtaaagtccagatgctggctcaggcagcggaa
gaacatcctctgcatggcggcaccggtattgctcacactcgctgggcgacccacggtgaa
ccttcagaagtgaatgcgcatccgcatgtttctgaacacattgtggtggtgcataacggc
atcatcgaaaaccatgaaccgctgcgcgaagagttaaaagcgcgtggctataccttcgtt
tctgaaaccgacaccgaagtgattgcccatctggtgaactgggagctgaaacagggcggt
actctgcgtgaggctgttctgcgtgctatcccgcaactgcgtggtgcgtacggtacagtg
atcatggactcccgtcacccggataccctgctggcagcacgttctggtagtccgctggtg
attggtctgggtatgggtgaaaactttatcgcttctgaccagctggcgctgctgccggtg
acccgtcgctttatcttccttgaagagggcgatattgcggaaatcactcgccgttcggta
aacatcttcgataaaactggcgcggaagtaaaacgtcaggatatcgaatccaatctgcaa
tatgacgcgggcgataaaggtatttaccgtcactacatgcagaaagagatctacgaacag
ccgaacgcgatcaaaaacacccttaccgggcgcatcagccacggtcaggttgatttaagc
gagctgggaccgaacgccgacgaactgctgtcgaaggttgagcatattcagatcctcgcc
tgtggtacttcttataactccggtatggtttcccgttactggtttgaatcgctggcaggt
attccgtgcgacgtcgaaatcgcctctgaattccgctatcgtaaatctgccgtgcgtcgt
aacagcctgatgatcaccttgtcacagtctggcgaaaccgcggataccctggcgggcctg
cgtctgtcgaaagagctgggttaccttggttcgctggcaatctgtaacgttccgggttct
tctctggtgcgcgaatccgatctggcgctgatgaccaacgcgggtacggaaatcggcgtg
gcatccactaaagcattcaccactcagttaactgtgctgttgatgctggtggcgaagctg
tctcgcctgaaaggtctggatgcctccattgaacatgacattgtgcatggtctgcaggcg
ctgccgagccgtattgagcagatgctgtctcaggacaaacgcattgaagctctggcagaa
gatttctctgacaaacatcacgcgctgttcctgggccgtggcgatcagtacccaatcgcg
ctggaaggcgcattgaagctgaaagagatctcttatattcacgctgaagcctacgctgca
ggcgaactgaaacacggtccgctggcgctgattgacgccgatatgccggttatcgtcgtt
gcgccgaacaacgaattgctggaaaaactgaaatccaacattgaagaagttcgcgcgcgt
ggcggccaattgtatgtcttcgccgagcaggatgcgggttttgtaagtagcgataacatg
cacatcatcgagatgccgaatgtggaagaggtgattgcaccgatcttctacaccgttccg
ctgcagttactggcttatcacgtcgcgctgatcaaaggcaccgacgttgaccagccgcgt
aacctggcaaaatcggtaacggttgagtaa

DBGET integrated database retrieval system