KEGG   Escherichia coli O157 H7 Sakai (EHEC): ECs4671Help
Entry
ECs4671           CDS       T00048                                 

Definition
glucosamine--fructose-6-phosphate aminotransferase (EC:2.6.1.16)
Orthology
K00820  
glucosamine--fructose-6-phosphate aminotransferase (isomerizing) [EC:2.6.1.16]
Organism
ecs  Escherichia coli O157:H7 Sakai (EHEC)
Pathway
Alanine, aspartate and glutamate metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ecs00520]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:ecs00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(4705284..4707113)
Genome map
AA seq 609 aa AA seqDB search
MCGIVGAIAQRDVAEILLEGLRRLEYRGYDSAGLAVVDAEGHMTRLRRLGKVQMLAQAAE
EHPLHGGTGIAHTRWATHGEPSEVNAHPHVSEHIVVVHNGIIENHEPLREELKARGYTFV
SETDTEVIAHLVNWELKQGGTLREAVLRAIPQLRGAYGTVIMDSRHPDTLLAARSGSPLV
IGLGMGENFIASDQLALLPVTRRFIFLEEGDIAEITRRSVNIFDKTGAEVKRQDIESNLQ
YDAGDKGIYRHYMQKEIYEQPNAIKNTLTGRISHGQVDLSELGPNADELLSKVEHIQILA
CGTSYNSGMVSRYWFESLAGIPCDVEIASEFRYRKSAVRRNSLMITLSQSGETADTLAGL
RLSKELGYLGSLAICNVPGSSLVRESDLALMTNAGTEIGVASTKAFTTQLTVLLMLVAKL
SRLKGLDASIEHDIVHGLQALPSRIEQMLSQDKRIEALAEDFSDKHHALFLGRGDQYPIA
LEGALKLKEISYIHAEAYAAGELKHGPLALIDADMPVIVVAPNNELLEKLKSNIEEVRAR
GGQLYVFAEQDAGFVSSDNMHIIEMPNVEEVIAPIFYTVPLQLLAYHVALIKGTDVDQPR
NLAKSVTVE
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaattgttggcgcgatcgcgcaacgtgatgtagcagaaatccttcttgaaggt
ttacgtcgtctggaataccgcggatatgactctgccggtctggccgttgttgatgcggaa
ggtcatatgacccgcctgcgtcgcctcggtaaagtccagatgctggctcaggcagcggaa
gaacatcctctgcatggcggcaccggtattgctcacactcgctgggcgacccacggtgaa
ccttcagaagtgaatgcgcatccgcatgtttctgaacacattgtggtggtgcataacggc
atcatcgaaaaccatgaaccgctgcgcgaagagttaaaagcgcgtggctataccttcgtt
tctgaaaccgacaccgaagtgattgcccatctggtgaactgggagctgaaacagggcggt
actctgcgtgaggctgttctgcgtgctatcccgcaactgcgtggtgcgtacggtacagtg
atcatggactcccgtcacccggataccctgctggcagcacgttctggtagtccgctggtg
attggtctgggtatgggtgaaaactttatcgcttctgaccagctggcgctgctgccggtg
acccgtcgctttatcttccttgaagagggcgatattgcggaaatcactcgccgttcggta
aacatcttcgataaaactggcgcggaagtaaaacgtcaggatatcgaatccaatctgcaa
tatgacgcgggcgataaaggtatttaccgtcactacatgcagaaagagatctacgaacag
ccgaacgcgatcaaaaacacccttaccgggcgcatcagccacggtcaggttgatttaagc
gagctgggaccgaacgccgacgaactgctgtcgaaggttgagcatattcagatcctcgcc
tgtggtacttcttataactccggtatggtttcccgttactggtttgaatcgctggcaggt
attccgtgcgacgtcgaaatcgcctctgaattccgctatcgtaaatctgccgtgcgtcgt
aacagcctgatgatcaccttgtcacagtctggcgaaaccgcggataccctggcgggcctg
cgtctgtcgaaagagctgggttaccttggttcgctggcaatctgtaacgttccgggttct
tctctggtgcgcgaatccgatctggcgctgatgaccaacgcgggtacggaaatcggcgtg
gcatccactaaagcattcaccactcagttaactgtgctgttgatgctggtggcgaagctg
tctcgcctgaaaggtctggatgcctccattgaacatgacattgtgcatggtctgcaggcg
ctgccgagccgtattgagcagatgctgtctcaggacaaacgcattgaagctctggcagaa
gatttctctgacaaacatcacgcgctgttcctgggccgtggcgatcagtacccaatcgcg
ctggaaggcgcattgaagctgaaagagatctcttatattcacgctgaagcctacgctgca
ggcgaactgaaacacggtccgctggcgctgattgacgccgatatgccggttatcgtcgtt
gcgccgaacaacgaattgctggaaaaactgaaatccaacattgaagaagttcgcgcgcgt
ggcggccaattgtatgtcttcgccgagcaggatgcgggttttgtaagtagcgataacatg
cacatcatcgagatgccgaatgtggaagaggtgattgcaccgatcttctacaccgttccg
ctgcagttactggcttatcacgtcgcgctgatcaaaggcaccgacgttgaccagccgcgt
aacctggcaaaatcggtaacggttgagtaa

DBGET integrated database retrieval system