KEGG   Escherichia coli O157 H7 Sakai (EHEC): ECs4751Help
Entry
ECs4751           CDS       T00048                                 

Definition
(RefSeq) phospholipase A
  KO
K01058  phospholipase A1/A2 [EC:3.1.1.32 3.1.1.4]
Organism
ecs  Escherichia coli O157:H7 Sakai (EHEC)
Pathway
ecs00564  Glycerophospholipid metabolism
ecs00565  Ether lipid metabolism
ecs00590  Arachidonic acid metabolism
ecs00592  alpha-Linolenic acid metabolism
ecs01100  Metabolic pathways
ecs01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ecs00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    ECs4751
   00565 Ether lipid metabolism
    ECs4751
   00590 Arachidonic acid metabolism
    ECs4751
   00591 Linoleic acid metabolism
    ECs4751
   00592 alpha-Linolenic acid metabolism
    ECs4751
Enzymes [BR:ecs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     ECs4751
    3.1.1.32  phospholipase A1
     ECs4751
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PLA1
Motif
Other DBs
NCBI-GeneID: 915153
NCBI-ProteinID: NP_312778
UniProt: P0A922
Structure
PDB: 

Jmol
Position
4801172..4802041
Genome map
AA seq 289 aa AA seqDB search
MRTLQGWLLPVFMLPMAVYAQEATVKEVHDAPAVRGSIIANMLQEHDNPFTLYPYDTNYL
IYTQTSDLNKEAIASYDWAENARKDEVKFQLSLAFPLWRGILGPNSVLGASYTQKSWWQL
SNSEESSPFRETNYEPQLFLGFATDYRFAGWTLRDVEMGYNHDSNGRSDPTSRSWNRLYT
RLMAENGNWLVEVKPWYVVGNTDDNPDITKYMGYYQLKIGYHLGDAVLSAKGQYNWNTGY
GGAELGLSYPITKHVRLYTQVYSGYGESLIDYNFNQTRVGVGVMLNDLF
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgcggactctgcagggctggttgttgccggtgtttatgttgcctatggcagtatatgca
caagaggcaacggtgaaagaggtgcatgacgcgccagcggtgcgtggcagtattatcgcc
aatatgctgcaggagcatgacaatccgttcacgctctatccttatgacaccaactacctc
atctacacccaaaccagcgatctgaacaaagaagcgattgccagttacgactgggcggaa
aatgcgcgtaaggatgaagtaaagtttcagttgagcctggcatttccgctgtggcgtggg
attttaggcccgaactcggtgttgggtgcgtcttatacgcaaaaatcctggtggcaactg
tccaatagcgaagagtcttcaccgtttcgtgaaaccaactacgaaccgcaattgttcctc
ggttttgccaccgattaccgttttgcaggttggacgctgcgcgatgtggagatggggtat
aaccacgactctaacgggcgttcagacccgacctcccgcagctggaaccgcctttatact
cgcctgatggcagaaaacggtaactggctggtagaagtgaagccgtggtatgtggtgggt
aatactgacgataacccggatatcaccaaatatatgggttactaccagcttaaaatcggc
tatcacctcggtgatgcggtgctcagtgcgaaaggacagtacaactggaacaccggctac
ggcggcgcggagttaggcttaagttacccgatcaccaaacatgtgcgcctttatactcag
gtttacagcggctatggcgaatcgctcatcgactataacttcaaccagacccgtgtcggt
gtgggggttatgctaaacgatttgttttga

DBGET integrated database retrieval system