KEGG   Escherichia coli O157 H7 Sakai (EHEC): ECs4962Help
Entry
ECs4962           CDS       T00048                                 

Definition
endolysin
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
ecs  Escherichia coli O157:H7 Sakai (EHEC)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5051389..5051889
Genome map
AA seq 166 aa AA seqDB search
MPKLPAPLRKKLIALVLAGAGTFTIATHYTGYWEGKENSTYIDPTGTPTICYGHTGPDVK
PGMTLTDEECLELLEKDMKWAFAAIDRRVQVPLTRGQTVALASWIFWAGETNFRNSTLLR
LINAGQMPASCKQYIRWIYSKGVKLPGLEARRSADEWLCRYDLPKV
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaactccccgcaccactgcgtaaaaagctgattgcccttgttctggccggtgcc
gggacgttcacgattgccacgcattacaccggttactgggaagggaaagaaaactccacg
tatatcgatcccaccggtacacccaccatctgttacggccataccggcccggatgtgaaa
ccgggtatgaccctgacagatgaagaatgcctggaactactggaaaaggacatgaaatgg
gcctttgcggccattgatcggcgtgttcaggtgccgcttacccgtggtcagacggtggcg
ctggcttcgtggatcttctgggccggtgaaacgaactttcgcaactccacgcttctgcgc
ctgatcaatgccgggcagatgcccgcgtcctgtaagcagtatatccgctggatttattca
aagggggtgaaactccccggccttgaggcccgccgttcggcggatgaatggttatgtcgc
tacgacttgccgaaagtctga

DBGET integrated database retrieval system