KEGG   Escherichia coli O7 K1 IAI39 (ExPEC): ECIAI39_0077Help
Entry
ECIAI39_0077      CDS       T00829                                 

Gene name
leuC
Definition
isopropylmalate isomerase large subunit (EC:4.2.1.33)
Orthology
K01703  
3-isopropylmalate/(R)-2-methylmalate dehydratase large subunit [EC:4.2.1.33 4.2.1.35]
Organism
ect  Escherichia coli O7:K1 IAI39 (ExPEC)
Pathway
Valine, leucine and isoleucine biosynthesis
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Class
Metabolism; Overview; 2-Oxocarboxylic acid metabolism [PATH:ect01210]
Metabolism; Overview; Biosynthesis of amino acids [PATH:ect01230]
Metabolism; Carbohydrate metabolism; C5-Branched dibasic acid metabolism [PATH:ect00660]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine biosynthesis [PATH:ect00290]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(89689..91089)
Genome map
AA seq 466 aa AA seqDB search
MAKTLYEKLFDAHVVYEAENETPLLYIDRHLVHEVTSPQAFDGLRAHGRPVRQPGKTFAT
MDHNVSTQTKDINACGEMARIQMQELIKNCKEFGVELYDLNHPYQGIVHVMGPEQGVTLP
GMTIVCGDSHTATHGAFGALAFGIGTSEVEHVLATQTLKQGRAKTMKIEVQGKAAPGITA
KDIVLAIIGKTGSAGGTGHVVEFCGEAIRDLSMEGRMTLCNMAIEMGAKAGLVAPDETTF
NYVKGRLHAPKGKDFDDAVAYWKTLQTDEGATFDTVVTLQAEEISPQVTWGTNPGQVISV
NDNIPDPASFADPVERASAEKALAYMGLKPGIPLTEVAIDKVFIGSCTNSRIEDLRAAAE
IAKGRKVAPGVQALVVPGSGPVKAQAEAEGLDKIFIEAGFEWRLPGCSMCLAMNNDRLNP
GERCASTSNRNFEGRQGRGGRTHLVSPAMAAAAAVTGHFADIRNIK
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atggctaagacgttatacgaaaaattattcgacgctcacgtagtgtacgaagccgaaaac
gaaaccccgctgttatatatcgaccgccacctggtgcatgaagtgacctcaccgcaggcg
ttcgatggtctgcgcgcccacggtcgcccggtacgtcagccggggaaaaccttcgccacc
atggatcacaacgtctctactcagaccaaagacattaatgcctgcggtgaaatggcgcgc
atccagatgcaggagctgatcaaaaactgcaaagaatttggcgtcgagctgtatgacctg
aatcacccgtatcaggggatcgtccacgtaatggggccggaacagggcgtcacattgccg
gggatgaccattgtctgcggcgactcacataccgccacccacggcgcgtttggcgcactg
gcctttggtatcggcacttccgaagttgaacacgtactggcaacgcaaaccctgaaacag
ggtcgtgcgaagaccatgaaaattgaagtccagggcaaagccgcgccgggcattaccgcg
aaagatatcgtgctggcgattatcggtaaaactggtagcgcaggcggcaccgggcatgtg
gtggagttttgcggcgaagcaatccgtgatttaagcatggaaggtcgtatgaccctgtgc
aatatggcaatcgaaatgggcgcgaaagccggtctggttgcaccggacgaaactaccttt
aactatgtcaaaggccgtctgcatgcgccgaaaggcaaagatttcgacgacgccgtcgcc
tactggaaaaccctgcaaaccgacgaaggcgcaactttcgataccgttgtcactctgcaa
gcagaagagatttcgccgcaggtcacctggggcaccaatccaggccaggtgatttccgtg
aacgacaatattcccgatccagcttcgtttgccgatccggttgaacgcgcgtcggcagaa
aaagcgctggcctatatggggctgaaaccgggtattccgctgaccgaagtggctatcgat
aaagtgtttatcggttcctgtaccaactcgcgcattgaagatttacgcgcggcagcggaa
atcgccaaagggcgaaaagtcgcgccaggcgtgcaggcactggtggttcccggctctggc
ccggtaaaagcccaggcggaagcggaaggtctggataaaatttttatcgaagccggtttt
gaatggcgcttgcctggctgctcaatgtgtctggcgatgaataacgaccgtctgaatccg
ggcgaacgttgtgcctccaccagtaaccgtaactttgaaggccgccaggggcgcggcggg
cgcacgcatctggtcagcccggctatggctgccgccgcggctgtgaccggacattttgcc
gacattcgcaacattaaataa

DBGET integrated database retrieval system