KEGG   Escherichia coli O7 K1 IAI39 (ExPEC): ECIAI39_0115Help
Entry
ECIAI39_0115      CDS       T00829                                 

Gene name
aceF
Definition
(RefSeq) dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ect  Escherichia coli O7:K1 IAI39 (ExPEC)
Pathway
ect00010  Glycolysis / Gluconeogenesis
ect00020  Citrate cycle (TCA cycle)
ect00620  Pyruvate metabolism
ect01100  Metabolic pathways
ect01110  Biosynthesis of secondary metabolites
ect01120  Microbial metabolism in diverse environments
ect01130  Biosynthesis of antibiotics
ect01200  Carbon metabolism
Module
ect_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ect00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECIAI39_0115 (aceF)
   00020 Citrate cycle (TCA cycle)
    ECIAI39_0115 (aceF)
   00620 Pyruvate metabolism
    ECIAI39_0115 (aceF)
Enzymes [BR:ect01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     ECIAI39_0115 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N GCV_H HlyD_D23 NQRA HlyD_3
Motif
Other DBs
NCBI-GeneID: 7150662
NCBI-ProteinID: YP_002406164
UniProt: A0A0H3MCU9
Structure
PDB: 

Jmol
Position
135799..137691
Genome map
AA seq 630 aa AA seqDB search
MAIEIKVPDIGADEVEITEILVKVGDKVEAEQSLITVEGDKASMEVPSPQAGIVKEIKVS
VGDKTQTGALIMIFDSADGAADAAPAQAEEKKEAAPAAAPAAAAAKDVNVPDIGSDEVEV
TEILVKVGDKVEAEQSLITVEGDKASMEVPAPFAGTVKEIKVNVGDKVSTGSLIMVFEVA
GEAGAAAPAAKQEAAPAAAPASAAGVKDVNVPDIGGDEVEVTEVMVKVGDKVAAEQSLIT
VEGDKASMEVPAPFAGVVKELKVNVGDKVKTGSLIMIFEVEGAAPAAAPAKQEAAAPAPA
AKAEAPAAAPAVKAEGKSEFAENDAYVHATPLIRRLAREFGVNLAKVKGTGRKGRILRED
VQAYVKEAIKRAEAAPAATGGGIPGMLPWPKVDFSKFGEIEEVELGRIQKISGANLSRNW
VMIPHVTHFDKTDITELEAFRKQQNEEAAKRKLDVKITPVVFIMKAVAAALEQMPRFNSS
LSEDGQRLTLKKYINIGVAVDTPNGLVVPVFKDVNKKGIIELSRELMTISKKARDGKLTA
GEMQGGCFTISSIGGLGTTHFAPIVNAPEVAILGVSKSAMEPVWNGKEFVPRLMLPISLS
FDHRVIDGADGARFITIINNTLSDIRRLVM
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgaaatcaaagtaccggacatcggggctgatgaagttgaaatcaccgagatc
ctggtcaaagtgggcgacaaagttgaagccgaacagtcgctgatcaccgtagaaggcgac
aaagcctctatggaagtaccatctccgcaggcgggtatcgttaaagagatcaaagtctct
gttggcgataaaactcagaccggcgcactgattatgattttcgattccgccgacggtgca
gcagacgctgcacctgctcaggcagaagagaagaaagaagcagctccggcagcagcacca
gcggctgccgcggcaaaagacgttaacgttccggatatcggcagcgacgaagttgaagtg
accgaaatcctggtgaaagttggcgataaagttgaagctgaacagtcgctgatcaccgta
gaaggcgataaagcttctatggaagttccggctccgtttgctggcaccgtgaaagagatc
aaagtgaacgtgggtgacaaagtgtctaccggctcgctgattatggtcttcgaagtcgcg
ggtgaagcaggcgcggcagctccggcggctaaacaggaagcggctccggcagcggcccct
gcatcagcggctggcgtgaaagacgttaacgttccggatatcggtggtgacgaagttgaa
gtgaccgaagtgatggtgaaagtgggcgacaaagttgccgctgaacagtcactgatcacc
gtagaaggcgataaagcgtctatggaagttccggctccgtttgcaggcgtcgtgaaggaa
ctgaaagtcaacgttggcgataaagtgaaaactggctcgctgattatgatcttcgaagtt
gaaggcgcagcgcctgcggcagctcctgcgaaacaggaagcggcagcgccggctccggca
gcaaaagctgaagctccggcagcagctccggctgtgaaagcggaaggcaaatctgaattt
gctgaaaatgacgcttacgttcacgcgactccgctgatccgccgtctggcacgcgagttt
ggcgttaacctggcgaaagtgaagggcactggccgtaaaggtcgtatcctgcgcgaagac
gttcaggcttacgtgaaagaagctataaaacgtgcagaagcggctccggcggcgactggc
ggcggtatcccgggcatgttgccgtggccgaaggtagacttcagcaagtttggtgaaatc
gaagaagtggaactgggccgcatccagaaaatttctggtgcgaacctgagccgtaactgg
gtgatgatcccgcatgttacccacttcgacaaaaccgatatcaccgagctggaagcgttc
cgtaaacagcagaacgaagaagcggcgaaacgtaagctggatgtgaagataaccccagtt
gtcttcatcatgaaagccgttgctgcagctcttgagcagatgcctcgcttcaacagttcg
ctgtcggaagacggtcagcgtctgaccctgaagaaatacatcaacatcggtgtggcggtg
gataccccgaacggtctggttgttccggtattcaaagacgtcaacaagaaaggcatcatc
gagctgtctcgcgagctgatgactatttctaagaaagcgcgtgacggtaagctgactgcg
ggcgaaatgcagggcggttgcttcaccatctccagcatcggcggcctgggtactacccac
ttcgcgccgattgtgaacgcgccggaagtggctatcctcggcgtttccaagtccgcgatg
gagccggtgtggaatggtaaagagttcgtgccgcgtctgatgctgccgatttctctctcc
ttcgaccaccgcgtgatcgacggtgctgatggtgcccgtttcattaccatcattaacaac
acgctgtctgacattcgccgtctggtgatgtaa

DBGET integrated database retrieval system