KEGG   Escherichia coli O7 K1 IAI39 (ExPEC): ECIAI39_0310Help
Entry
ECIAI39_0310      CDS       T00829                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
ect  Escherichia coli O7:K1 IAI39 (ExPEC)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:ect00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
343009..343983
Genome map
AA seq 324 aa AA seqDB search
MTDLIQRPRRLRKSPALRAMFEETTLSLNDLVLPIFVEEEIDDYKAVEAMPGVMRIPEKH
LAREIERIANAGIRSVMTFGISHHTDETGSDAWREDGLVARMSRICKQTVPEMIVMSDTC
FCEYTSHGHCGVLCEHGVDNDATLENLGKQAVVAAAAGADFIAPSAAMDGQVQAIRQALD
AAGFKDTAIMSYSTKFASSFYGPFREAAGSALKGDRKSYQMNPMNRREAIRESLLDEAQG
ADCLMVKPAGAYLDIVRELRERTELPIGAYQVSGEYAMIKFAALAGAIDEEKVVLESLGS
IKRAGADLIFSYFALDLAEKKILR
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgacagatttaatccaacgccctcgtcgcctgcgcaaatctcctgcgctgcgcgctatg
tttgaagagacaacacttagccttaacgacctggtgttgccgatctttgttgaagaagaa
attgacgactacaaagccgttgaagccatgccaggcgtgatgcgcattccagagaaacat
ctggcacgcgaaattgaacgcatcgccaacgccggtattcgttccgtgatgactttcggc
atttcccaccataccgatgaaaccggcagcgatgcctggcgggaagatggactggtggcg
cggatgtcgcgcatctgcaagcagactgtgccagaaatgatcgttatgtcagacacctgc
ttctgtgaatacacttctcacggtcactgcggtgtgctgtgcgagcatggcgtcgacaac
gacgcgactctggaaaatttaggcaagcaagccgtggttgcagctgctgcaggcgcagac
ttcatcgccccttccgccgcgatggacggccaggtacaggcaattcgccaggcgctggac
gctgcgggctttaaagatacggcgattatgtcgtattcgaccaagttcgcctcctccttt
tatggcccgttccgtgaagctgccggaagcgcattaaaaggcgaccgcaaaagctatcag
atgaatccaatgaaccgtcgtgaggcgattcgtgaatcactgctggatgaagcccagggc
gcagactgcctgatggttaaacctgctggagcgtacctcgacatcgtgcgtgagctgcgt
gaacgtactgaattgccgattggcgcgtatcaggtgagcggtgagtacgcgatgattaag
ttcgccgcgctggcgggtgctatagatgaagagaaagttgtgctcgaaagcttaggttcg
attaagcgtgcgggtgcggatctgattttcagctactttgcgctggatttggctgagaag
aagattctgcgttaa

DBGET integrated database retrieval system