KEGG   Escherichia coli O7 K1 IAI39 (ExPEC): ECIAI39_0631Help
Entry
ECIAI39_0631      CDS       T00829                                 

Gene name
asnB
Definition
asparagine synthetase B (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
ect  Escherichia coli O7:K1 IAI39 (ExPEC)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:ect00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(666938..668602)
Genome map
AA seq 554 aa AA seqDB search
MCSIFGVFDIKTDAVELRKKALELSRLMRHRGPDWSGIYASDNAILAHERLSIVDVNAGA
QPLYNQQKTHVLAVNGEIYNHQALRAEYGDRYQFQTGSDCEVILALYQEKGPEFLDDLQG
MFAFALYDSEKDAYLIGRDHLGIIPLYMGYDEHGQLYVASEMKALVPVCRTIKEFPAGSY
LWSQDGEIRSYYHRDWFDYDAVKDNVTDKNELRQALEDSVKSHLMSDVPYGVLLSGGLDS
SIISAITKKYAARRVEDQERSEAWWPQLHSFAVGLPGSPDLKAAQEVANHLGTVHHEIHF
TVQEGLDAIRDVIYHIETYDVTTIRASTPMYLMSRKIKAMGIKMVLSGEGSDEVFGGYLY
FHKAPNAKELHEETVRKLLALHMYDCARANKAMSAWGVEARVPFLDKKFLDVAMRINPQD
KMCGNGKMEKHILRECFEAYLPASVAWRQKEQFSDGVGYSWIDTLKEVAAQQVSDQQLET
ARFRFPYNTPTSKEAYLYREIFEELFPLPSAAECVPGGPSVACSSAKAIEWDEAFKKMDD
PSGRAVGVHQSAYK
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgtgttcaatttttggcgtattcgatatcaaaacagacgcagttgagctgcggaagaaa
gccctcgagctgtcacgcctgatgcgtcatcgtggcccggactggtccggtatttatgcc
agcgataacgccattctcgctcacgaacgtctgtcaattgttgacgttaacgcaggggcg
caacctctctacaaccaacaaaaaacccacgtactggcggtaaacggtgaaatctacaac
caccaggcactgcgcgccgaatatggcgatcgttatcagttccagaccggatctgactgc
gaagtgatcctcgcgctgtatcaggaaaaagggccggaatttcttgacgacttgcagggc
atgtttgcctttgccctgtacgacagcgaaaaagatgcctacctgattggtcgcgaccat
ctggggatcatcccactgtatatgggctatgacgaacatggtcagctgtatgtggcctca
gaaatgaaagccctggtgccggtatgccgcacgattaaagagttcccggcggggagctat
ttgtggagtcaggacggcgaaatccgttcttattatcatcgcgactggttcgactacgat
gcggtgaaagataacgtgaccgacaaaaacgagctgcgtcaggcactggaagattccgtt
aaaagccatctgatgtctgatgtgccttacggtgtgctgctatctggtggcctggattcc
tcaatcatttccgctatcaccaagaaatacgccgcccgtcgcgtggaagatcaggaacgc
tctgaagcctggtggccgcagctgcactcctttgctgtaggtctgccgggttcaccggat
ctgaaggcagcccaggaagtggcaaaccatctgggcactgtgcatcatgaaattcacttc
actgtacaggaaggtctggacgccatccgcgacgtgatttaccacatcgaaacctatgat
gtgaccactattcgcgcttcaacaccgatgtatttaatgtcgcgtaagatcaaggcgatg
ggcattaaaatggtgctgtccggtgagggttctgatgaagtgtttggcggttatctttac
ttccacaaagcgccgaacgctaaagagttgcatgaagagacggtgcgtaaactgctggcc
ctgcatatgtatgactgcgcgcgtgccaacaaagcgatgtcagcctggggcgtggaagca
cgcgttccgttcctcgacaaaaaattcctcgacgtggcaatgcgcattaacccacaggat
aaaatgtgcggtaacggcaaaatggaaaaacacatcctgcgtgaatgttttgaagcgtat
ctgcccgcaagcgtggcctggcggcagaaagagcagttctccgatggcgtcggttacagt
tggatcgacaccctgaaagaagtggcggcgcagcaggtttctgatcaacagctggaaact
gcccgcttccgcttcccgtacaacacgccgacgtccaaagaagcgtatctgtaccgcgag
atctttgaagaactgttcccgcttccgagcgccgctgagtgcgtgccgggcggtccttcc
gtcgcgtgttcttccgctaaagcgatcgaatgggatgaagcgttcaaaaaaatggacgat
ccatctggtcgtgcggttggtgttcaccagtcggcgtataagtaa

DBGET integrated database retrieval system