KEGG   Escherichia coli O7 K1 IAI39 (ExPEC): ECIAI39_0723Help
Entry
ECIAI39_0723      CDS       T00829                                 

Gene name
gpmA
Definition
phosphoglyceromutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ect  Escherichia coli O7:K1 IAI39 (ExPEC)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ect00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ECIAI39_0723 (gpmA)
   01230 Biosynthesis of amino acids
    ECIAI39_0723 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECIAI39_0723 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    ECIAI39_0723 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ECIAI39_0723 (gpmA)
Enzymes [BR:ect01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     ECIAI39_0723 (gpmA)
Exosome [BR:ect04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   ECIAI39_0723 (gpmA)
  Exosomal proteins of melanoma cells
   ECIAI39_0723 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(765689..766441)
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGYSFDFAYTSVL
KRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFA
VTPPELTKDDERYPGHDPRYAKLSEKELPLTESLALTIDRVIPYWNETILPRMKSGERVI
IAAHGNSLRALVKYLDNMSEEEILELNIPTGVPLVYEFDENFKPLKRYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaactaagctggttctggttcgtcatggcgaaagtcagtggaacaaagaaaac
cgtttcaccggttggtacgacgtggatctgtctgagaaaggcgtaagcgaagcaaaagca
gcaggtaagctgctgaaagaggaaggttacagctttgactttgcttacacttctgtgctg
aaacgcgctatccataccctgtggaatgtgctggacgaactggatcaggcatggctgccc
gttgagaaatcctggaaactgaacgaacgtcactacggtgcgttgcagggtctgaacaaa
gcggaaactgctgaaaagtatggcgacgagcaggtgaaacagtggcgtcgtggttttgca
gtgactccgccggaactgactaaagatgatgagcgttatccgggtcacgatccgcgttac
gcgaaactgagcgagaaagaactgccgctgacggaaagcctggcgctgaccattgaccgc
gtgatcccttactggaatgaaaccattctgccgcgtatgaagagcggtgagcgcgtcatc
atcgctgcacacggtaactcgttacgtgcgctggtgaaatatctcgataacatgagcgaa
gaagagattcttgagctgaatatcccgaccggtgtgccgctggtttatgagtttgacgag
aacttcaaaccgctgaaacgctattatctgggtaatgctgacgagatcgcggcgaaagca
gcggcggttgctaaccagggtaaagcgaagtaa

DBGET integrated database retrieval system