KEGG   Escherichia coli O7 K1 IAI39 (ExPEC): ECIAI39_0723Help
Entry
ECIAI39_0723      CDS       T00829                                 

Gene name
gpmA
Definition
(RefSeq) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ect  Escherichia coli O7:K1 IAI39 (ExPEC)
Pathway
ect00010  Glycolysis / Gluconeogenesis
ect00260  Glycine, serine and threonine metabolism
ect00680  Methane metabolism
ect01100  Metabolic pathways
ect01110  Biosynthesis of secondary metabolites
ect01120  Microbial metabolism in diverse environments
ect01130  Biosynthesis of antibiotics
ect01200  Carbon metabolism
ect01230  Biosynthesis of amino acids
Module
ect_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ect_M00002  Glycolysis, core module involving three-carbon compounds
ect_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ect00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECIAI39_0723 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    ECIAI39_0723 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ECIAI39_0723 (gpmA)
Enzymes [BR:ect01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     ECIAI39_0723 (gpmA)
Membrane trafficking [BR:ect04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    ECIAI39_0723 (gpmA)
Exosome [BR:ect04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   ECIAI39_0723 (gpmA)
  Exosomal proteins of melanoma cells
   ECIAI39_0723 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 TAF6_C
Motif
Other DBs
NCBI-GeneID: 7150781
NCBI-ProteinID: YP_002406749
UniProt: B7NNH7
Structure
PDB: 

Jmol
Position
complement(765689..766441)
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGYSFDFAYTSVL
KRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFA
VTPPELTKDDERYPGHDPRYAKLSEKELPLTESLALTIDRVIPYWNETILPRMKSGERVI
IAAHGNSLRALVKYLDNMSEEEILELNIPTGVPLVYEFDENFKPLKRYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaactaagctggttctggttcgtcatggcgaaagtcagtggaacaaagaaaac
cgtttcaccggttggtacgacgtggatctgtctgagaaaggcgtaagcgaagcaaaagca
gcaggtaagctgctgaaagaggaaggttacagctttgactttgcttacacttctgtgctg
aaacgcgctatccataccctgtggaatgtgctggacgaactggatcaggcatggctgccc
gttgagaaatcctggaaactgaacgaacgtcactacggtgcgttgcagggtctgaacaaa
gcggaaactgctgaaaagtatggcgacgagcaggtgaaacagtggcgtcgtggttttgca
gtgactccgccggaactgactaaagatgatgagcgttatccgggtcacgatccgcgttac
gcgaaactgagcgagaaagaactgccgctgacggaaagcctggcgctgaccattgaccgc
gtgatcccttactggaatgaaaccattctgccgcgtatgaagagcggtgagcgcgtcatc
atcgctgcacacggtaactcgttacgtgcgctggtgaaatatctcgataacatgagcgaa
gaagagattcttgagctgaatatcccgaccggtgtgccgctggtttatgagtttgacgag
aacttcaaaccgctgaaacgctattatctgggtaatgctgacgagatcgcggcgaaagca
gcggcggttgctaaccagggtaaagcgaagtaa

DBGET integrated database retrieval system