KEGG   Escherichia coli O7 K1 IAI39 (ExPEC): ECIAI39_0973Help
Entry
ECIAI39_0973      CDS       T00829                                 

Gene name
galF
Definition
UTP--glucose-1-phosphate uridylyltransferase subunit GalF
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ect  Escherichia coli O7:K1 IAI39 (ExPEC)
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ect00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ECIAI39_0973 (galF)
   00052 Galactose metabolism
    ECIAI39_0973 (galF)
   00500 Starch and sucrose metabolism
    ECIAI39_0973 (galF)
   00520 Amino sugar and nucleotide sugar metabolism
    ECIAI39_0973 (galF)
Enzymes [BR:ect01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     ECIAI39_0973 (galF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1040547..1041440
Genome map
AA seq 297 aa AA seqDB search
MTNLKAVIPVAGLGMHMLPATKAIPKEMLPIVDKPMIQYIVDEIVAAGIKEILLVTHASK
NAVENHFDTSYELESLLEQRVKRQLLAEVQSICPPGVTIMNVRQGEPLGLGHSILCARPA
IGDNPFVVVLPDVVIDDASADPLRYNLAAMIARFNETGRSQVLAKRMPGDLSEYSVIQTK
EPLDREGKVSRIVEFIEKPDQPQTLDSDIMAVGRYVLSADIWPELERTQPGAWGRIQLTD
AIAELAKKQSVDAMLMTGDSYDCGKKMGYMQAFVKYGLRNLKEGAKFRKGIEKLLSE
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatttaaaagcagttattcctgtagcgggtcttgggatgcatatgttgcctgcc
actaaggcgattcccaaagagatgctaccgatcgtcgacaagccaatgattcagtacatc
gttgacgagattgtggctgcagggatcaaagaaatcctcctggtaactcacgcttccaag
aacgcggtcgaaaaccacttcgacacctcttatgaattagaatctctccttgaacagcgc
gtgaagcgtcaactgctggcggaagtacagtccatttgcccgccgggcgtgacaattatg
aacgtgcgtcagggcgaacctttaggtttgggccactccattttatgtgcacgacctgcc
attggtgacaatccatttgtcgtggtgctgccagacgttgtgatcgacgacgccagcgcc
gacccgctgcgctacaaccttgctgccatgattgcgcgcttcaacgaaacgggccgcagc
caggtgctggcaaaacgtatgccgggtgacctctctgaatactctgtcatccagaccaaa
gagccgctggaccgcgaaggtaaagtcagccgcattgttgaattcatcgaaaaaccggat
cagccgcagacgctggactcagacatcatggccgttggtcgctatgtgctttctgcagat
atttggccggaacttgaacgcactcagcctggtgcatgggggcgtattcagctgactgat
gccatcgctgaactggcgaaaaaacagtccgttgatgccatgctgatgacaggtgacagc
tacgactgcggtaaaaaaatggggtatatgcaggcatttgtgaagtatggactacgcaac
ctgaaagaaggggcgaagttccgtaaagggattgagaagctgttaagcgagtaa

DBGET integrated database retrieval system