KEGG   Escherichia coli O7 K1 IAI39 (ExPEC): ECIAI39_1167Help
Entry
ECIAI39_1167      CDS       T00829                                 

Gene name
cheB
Definition
(RefSeq) chemotaxis-specific methylesterase
  KO
K03412  two-component system, chemotaxis family, protein-glutamate methylesterase/glutaminase [EC:3.1.1.61 3.5.1.44]
Organism
ect  Escherichia coli O7:K1 IAI39 (ExPEC)
Pathway
ect02020  Two-component system
ect02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:ect00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    ECIAI39_1167 (cheB)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    ECIAI39_1167 (cheB)
Enzymes [BR:ect01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     ECIAI39_1167 (cheB)
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.44  protein-glutamine glutaminase
     ECIAI39_1167 (cheB)
Two-component system [BR:ect02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   ECIAI39_1167 (cheB)
Bacterial motility proteins [BR:ect02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    ECIAI39_1167 (cheB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheB_methylest Response_reg
Motif
Other DBs
NCBI-GeneID: 7150936
NCBI-ProteinID: YP_002407175
UniProt: A0A0H3MFM3
Position
1236226..1237275
Genome map
AA seq 349 aa AA seqDB search
MSKIRVLSVDDSALMRQIMTEIINSHSDMEMVATAPDPLVARDLIKKFNPDVLTLDVEMP
RMDGLDFLEKLMRLRPMPVVMVSSLTGKGSEVTLRALELGAIDFVTKPQLGIREGMLAYS
EMIAEKVRTAAKASLAAHKPLSAPTTLKAGPLLSSEKLIAIGASTGGTEAIRHVLQPLPL
SSPALLITQHMPPGFTRSFADRLNKLCQIGVKEAEDGERVLPGHAYIAPGDRHMELARSG
ANYQIKIHDGPAVNRHRPSVDVLFHSVAKQAGRNAVGVILTGMGNDGAAGMLAMRQAGAW
TLAQNEASCVVFGMPREAINMGGVCEVVDLSQVSQQMLAKISAGQAIRI
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaatcagggtgttatctgtcgatgattcggcactgatgcgccagatcatgaca
gaaatcatcaacagccatagcgacatggaaatggtggcgactgcccctgatccgctggtt
gcgcgtgatttgattaagaaattcaatcccgatgtattgacgctggatgttgaaatgccg
cggatggacggactggatttcctcgaaaaattaatgcgtttgcgtccaatgcccgttgtg
atggtttcttccctgaccggcaaagggtcagaagtcacgctgcgcgcgctggagctgggg
gcgatagattttgtcaccaaaccgcaactgggtattcgcgaaggaatgctggcgtatagc
gaaatgattgctgaaaaggtgcgtacggcagcaaaggcgagccttgcagcacataagcca
ttgtcggctccgacaacgctgaaggcggggccgttgttgagttctgaaaaactgattgcg
attggtgcttcaacgggtggaactgaggcaattcgtcacgtactgcaaccgttgccgctt
tccagtccggcactgttaattacccagcatatgccgcccggtttcacccgctcttttgcc
gacagacttaataagctttgccagatcggagttaaagaagccgaagacggagagcgcgtc
ttgccgggacatgcctatatcgcgccgggcgatcggcatatggagctggcgcgtagtggc
gcaaattatcaaatcaaaattcacgatggcccggcggttaatcgccatcggccatcggtt
gatgtgttgttccattctgtggccaaacaggcggggcgtaatgcggttggggtgatccta
accggtatgggcaacgacggcgcggcgggaatgttggcgatgcgtcaggcgggggcatgg
acccttgcgcaaaacgaagcaagttgcgtggtgttcggcatgccgcgcgaggccatcaat
atgggtggtgtctgcgaagtggtcgatcttagccaggtaagtcagcaaatgctggcaaaa
attagtgccggacaggcgatacgtatttaa

DBGET integrated database retrieval system