KEGG   Escherichia coli O7 K1 IAI39 (ExPEC): ECIAI39_1331Help
Entry
ECIAI39_1331      CDS       T00829                                 

Gene name
pfkB
Definition
(RefSeq) 6-phosphofructokinase 2
  KO
K16370  6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
ect  Escherichia coli O7:K1 IAI39 (ExPEC)
Pathway
ect00010  Glycolysis / Gluconeogenesis
ect00030  Pentose phosphate pathway
ect00051  Fructose and mannose metabolism
ect00052  Galactose metabolism
ect00680  Methane metabolism
ect01100  Metabolic pathways
ect01110  Biosynthesis of secondary metabolites
ect01120  Microbial metabolism in diverse environments
ect01130  Biosynthesis of antibiotics
ect01200  Carbon metabolism
ect01230  Biosynthesis of amino acids
Module
ect_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ect00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECIAI39_1331 (pfkB)
   00030 Pentose phosphate pathway
    ECIAI39_1331 (pfkB)
   00051 Fructose and mannose metabolism
    ECIAI39_1331 (pfkB)
   00052 Galactose metabolism
    ECIAI39_1331 (pfkB)
  Energy metabolism
   00680 Methane metabolism
    ECIAI39_1331 (pfkB)
Enzymes [BR:ect01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     ECIAI39_1331 (pfkB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin DUF2617
Motif
Other DBs
NCBI-GeneID: 7153614
NCBI-ProteinID: YP_002407339
UniProt: A0A0H3MK62
Structure
PDB: 

Jmol
Position
complement(1396012..1396941)
Genome map
AA seq 309 aa AA seqDB search
MVRIYTLTLAPSLDSATITPQIYPEGKLRCTAPVFEPGGGGINVARAIAHLGGSATAIFP
AGGATGEHLVSLLADENVPVATVEAKDWTRQNLHVHVEASGEQYRFVMPGAALSEDEFRQ
LEEQVLEIESGAILVISGSLPPGVKLEKLTQLISAAQKQGIRCIVDSSGEALSAALAIGN
IELVKPNQKELSALVNRELTQPDDVRKAAQEIVNSGKAKRVVVSLGPQGALGVDSENCIQ
VVPPPVKSQSTVGAGDSMVGAMTLKLAENASLKEMVRFGVAAGSAATLNQGTRLCSHDDT
QKIYAYLSR
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggtacgtatctatacgttgacacttgcgccctctctcgatagcgcaacaattaccccg
caaatttatcccgaaggaaagctgcgctgtaccgcaccggtattcgaacccggaggcggc
ggcatcaacgtcgcccgcgccattgcccatcttggaggcagtgccacagcgatcttcccg
gcgggtggtgcgaccggcgaacatctggtttcactgttggcagatgaaaatgtccccgtc
gctactgtagaagccaaagactggacccggcagaatttacacgtacatgtggaagcaagc
ggtgagcagtatcgttttgtcatgccaggcgcggcattaagtgaagatgagtttcgccag
cttgaagagcaagttctggaaattgaatccggtgctatcctggtcataagcggaagcctg
ccgccaggtgtgaagctggaaaaattaacccaactgatttccgctgcgcaaaaacaaggg
attcgctgcatcgtcgacagttctggcgaagcgttaagtgcagcactggcgattggtaat
atcgagttggttaagcctaaccaaaaagaactcagtgcgctagtgaatcgcgaactcacc
cagccagacgatgtccgcaaagccgcgcaggaaatcgttaatagcggcaaggccaaacga
gttgtcgtttccctgggtccacaaggggcgttgggcgttgatagtgaaaactgcattcag
gttgtgccaccaccggtgaaaagccagagcaccgttggcgctggtgacagcatggtcggc
gcgatgacactgaaactggcagaaaatgcctctcttaaagagatggtccgttttggcgta
gctgcggggagtgcagccacactcaatcagggaacacgcctgtgctcccatgacgataca
caaaaaatttacgcttacctttcccgctaa

DBGET integrated database retrieval system