KEGG   Escherichia coli O7 K1 IAI39 (ExPEC): ECIAI39_1452Help
Entry
ECIAI39_1452      CDS       T00829                                 

Gene name
folM
Definition
short chain dehydrogenase (EC:1.5.1.3)
Orthology
K13938  
dihydromonapterin reductase / dihydrofolate reductase [EC:1.5.1.- 1.5.1.3]
Organism
ect  Escherichia coli O7:K1 IAI39 (ExPEC)
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ect00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:ect00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1526806..1527528)
Genome map
AA seq 240 aa AA seqDB search
MGKTQSLPILITGGGRRIGLALAWHFINQKQPVIVSYRTHYPTIDGLIKAGAQCIQADFS
TNDGVMAFADEVLKSTHGLRAILHNASAWMAEKPGAPLTDVLACMMQIHVNTPYLLNHAL
ERLLRGHGHAASDIIHFTDYVVERGSDKHIAYAASKAALDNMTRSFARKLAPEVKVNSIA
PSLILFNEHDDAEYRQQALNKSLMKTAPGEKEVIDLVDYLLTSCFVTGRSLPLDGGRHLR
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaaacccagtccttgccaatattaattactggcggaggtcgccgcatcggcctc
gccctcgcatggcatttcattaatcaaaagcaaccggtgattgtcagctatcggacgcac
tatcccaccattgatggactgattaaggcaggtgcgcagtgtattcaggctgatttttcg
accaacgacggtgtgatggcgtttgccgatgaagtactaaaaagcacccatggtctgcgt
gctattttgcataacgccagcgcgtggatggcggaaaaaccgggagcgccactgaccgac
gtactggcttgcatgatgcagatccacgttaataccccatacctgctcaaccatgctctg
gaaagattactgcgtgggcacggacacgccgccagcgatatcattcactttaccgattat
gtggtggagcgcggtagcgacaaacatattgcctatgctgcaagcaaagcggcactggat
aatatgacccgctcgtttgcccgcaagctggcaccggaagtgaaagtgaattctattgcg
ccatcgctgatcctgtttaatgaacatgatgatgccgaatatcgacaacaggcgctgaat
aaatcactgatgaaaaccgcgcctggcgagaaagaagtgatcgacctggtcgattactta
cttaccagctgctttgtcaccggacgcagtctcccacttgatggcggtcgtcatctgcgt
taa

DBGET integrated database retrieval system