KEGG   Escherichia coli O7 K1 IAI39 (ExPEC): ECIAI39_1544Help
Entry
ECIAI39_1544      CDS       T00829                                 

Gene name
ipk
Definition
(RefSeq) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
ect  Escherichia coli O7:K1 IAI39 (ExPEC)
Pathway
ect00900  Terpenoid backbone biosynthesis
ect01100  Metabolic pathways
ect01110  Biosynthesis of secondary metabolites
ect01130  Biosynthesis of antibiotics
Module
ect_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:ect00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ECIAI39_1544 (ipk)
Enzymes [BR:ect01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     ECIAI39_1544 (ipk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-GeneID: 7152499
NCBI-ProteinID: YP_002407544
UniProt: B7NUX4
Structure
PDB: 

Jmol
Position
complement(1613581..1614432)
Genome map
AA seq 283 aa AA seqDB search
MRTQWPSPAKLNLFLYITGQRADGYHTLQTLFQFLDYGDTINIELRDDGDIRLLTPVEGV
EHEDNLIVRAARLLMKTAADSGRLPTGSGANISIDKRLPMGGGLGGGSSNAATVLVALNH
LWQCGLSMDELAEMGLTLGADVPVFVRGHAAFAEGVGEILTPVDPPEKWYLVAHPGVSIP
TPVIFKDPELPRNTPKRSIETLLKCEFSNDCEVIARKRFREVDAVLSWLLEYAPSRLTGT
GACVFAEFDTESEARQVLEQAPEWLNGFVAKGVNLSPLHRAML
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgcggacacagtggccctctccggcaaaacttaatctgtttttatacattaccggtcag
cgtgcggatggttaccacacgctgcaaacgctgtttcagtttcttgattacggcgacacc
atcaacattgagcttcgtgacgatggggatattcgtctgttaacgcccgttgaaggcgtg
gaacatgaagataacctgatcgttcgcgcagcgcggttattgatgaaaactgcggcagac
agcgggcgtcttccgacgggaagcggtgcgaatatcagcattgacaagcgtttgccgatg
ggcggcggtctcggcggtggttcatccaatgccgcgacggtcctggtggcattaaatcat
ctctggcaatgcgggctaagcatggatgagctggcggaaatgggactgacgctgggcgca
gatgttcctgtctttgttcgggggcatgccgcgtttgccgaaggcgttggtgaaatacta
acgccggtggatccgccagagaagtggtatctggtggcgcaccctggtgtaagtattccg
acaccggtgatttttaaagatcctgaactcccgcgcaatacgccaaaaaggtcaatagaa
acgttgctaaaatgtgaattcagcaatgattgcgaggttatcgcaagaaaacgttttcgc
gaggttgatgcggtgctttcctggctgttagaatacgccccgtcgcgcctgactgggaca
ggggcctgtgtctttgctgaatttgatacagagtctgaagcccgccaggtgctagagcaa
gccccggaatggctcaatggctttgtggcgaaaggcgttaatctttccccattgcacaga
gccatgctttaa

DBGET integrated database retrieval system