KEGG   Escherichia coli O7 K1 IAI39 (ExPEC): ECIAI39_1575Help
Entry
ECIAI39_1575      CDS       T00829                                 

Gene name
adhE
Definition
(RefSeq) bifunctional acetaldehyde-CoA/alcohol dehydrogenase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
ect  Escherichia coli O7:K1 IAI39 (ExPEC)
Pathway
ect00010  Glycolysis / Gluconeogenesis
ect00071  Fatty acid degradation
ect00350  Tyrosine metabolism
ect00620  Pyruvate metabolism
ect00625  Chloroalkane and chloroalkene degradation
ect00626  Naphthalene degradation
ect00650  Butanoate metabolism
ect01100  Metabolic pathways
ect01110  Biosynthesis of secondary metabolites
ect01120  Microbial metabolism in diverse environments
ect01130  Biosynthesis of antibiotics
ect01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ect00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECIAI39_1575 (adhE)
   00620 Pyruvate metabolism
    ECIAI39_1575 (adhE)
   00650 Butanoate metabolism
    ECIAI39_1575 (adhE)
  Lipid metabolism
   00071 Fatty acid degradation
    ECIAI39_1575 (adhE)
  Amino acid metabolism
   00350 Tyrosine metabolism
    ECIAI39_1575 (adhE)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    ECIAI39_1575 (adhE)
   00626 Naphthalene degradation
    ECIAI39_1575 (adhE)
Enzymes [BR:ect01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     ECIAI39_1575 (adhE)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     ECIAI39_1575 (adhE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2 HTH_AsnC-type
Motif
Other DBs
NCBI-GeneID: 7151810
NCBI-ProteinID: YP_002407575
UniProt: A0A0H3MH67
Position
complement(1646073..1648748)
Genome map
AA seq 891 aa AA seqDB search
MAVTNVAELNALVERVKKAQREYASFTQEQVDKIFRAAALAAADARIPLAKMAVAESGMG
IVEDKVIKNHFASEYIYNAYKDEKTCGVLSEDDTFGTITIAEPIGIICGIVPTTNPTSTA
IFKSLISLKTRNAIIFSPHPRAKDATNKAADIVLQAAIAAGAPKDLIGWIDQPSVELSNA
LMHHPDINLILATGGPGMVKAAYSSGKPAIGVGAGNTPVVIDETADIKRAVASVLMSKTF
DNGVICASEQSVVVVDSVYDAVRERFATHGGYLLQGKELKAVQDVILKNGALNAAIVGQP
AYKIAELAGFSVPENTKILIGEVTVVDESEPFAHEKLSPTLAMYRAKDFEDAVEKAEKLV
AMGGIGHTSCLYTDQDNQPARVSYFGQKMKTARILINTPASQGGIGDLYNFKLAPSLTLG
CGSWGGNSISENVGPKHLINKKTVAKRAENMLWHKLPKSIYFRRGSLPIALDEVITDGHK
RALIVTDRFLFNNGYADQITSVLKAAGVETEVFFEVEADPTLSIVRKGAELANSFKPDVI
IALGGGSPMDAAKIMWVMYEHPETHFEELALRFMDIRKRIYKFPKMGVKAKMIAVTTTSG
TGSEVTPFAVVTDDATGQKYPLADYALTPDMAIVDANLVMDMPKSLCAFGGLDAVTHAME
AYVSVLASEFSDGQALQALKLLKEYLPASYHEGSKNPVARERVHSAATIAGIAFANAFLG
VCHSMAHKLGSQFHIPHGLANALLICNVIRYNANDNPTKQTAFSQYDRPQARRRYAEIAD
HLGLSAPGDRTAAKIEKLLAWLETLKAELGIPKSIREAGVQEADFLANVDKLSEDAFDDQ
CTGANPRYPLISELKQILLDTYYGRDYVEGETAAKKEAAPAKVEKKAKKSA
NT seq 2676 nt NT seq  +upstreamnt  +downstreamnt
atggctgttactaatgtcgctgaacttaacgcactcgtagagcgtgtaaaaaaagcccag
cgtgaatatgccagtttcactcaagagcaagtagacaaaatcttccgcgccgccgctctg
gctgctgcagatgctcgaatcccactcgcgaaaatggccgttgccgaatccggcatgggt
atcgtcgaagataaagtgatcaaaaaccactttgcttctgaatatatctacaacgcctat
aaagatgaaaaaacctgtggtgttctgtctgaagacgacacttttggtaccatcactatc
gctgaacccatcggtattatttgcggtatcgttccgaccactaacccgacttcaactgct
atcttcaaatcgctgatcagcctgaagacccgtaacgccattatcttctccccgcacccg
cgtgcaaaagatgcaaccaacaaagcggctgatatcgttctacaggctgctatcgctgcc
ggtgctccgaaagatctgatcggctggatcgatcaaccttctgttgaactgtctaacgca
ctgatgcaccacccagacatcaacctgatcctcgcgactggtggtccgggcatggttaaa
gccgcatacagctccggtaaaccagctatcggcgtaggcgcgggcaacactccggttgtt
atcgatgaaactgctgatatcaaacgtgcagttgcatctgtgttgatgtccaaaaccttc
gacaacggcgtaatctgtgcttctgaacagtctgttgttgttgttgactctgtttatgac
gcagtacgtgaacgtttcgcaacccacggcggctatctgttgcagggtaaagagctgaaa
gctgttcaggatgttatcctgaaaaacggtgcgctgaacgcggctatcgttggtcagcca
gcctacaaaattgctgaactggcaggcttctctgtaccagaaaacaccaagattctgatc
ggtgaagtgaccgttgttgatgaaagcgaaccgttcgcacatgaaaaactgtccccgact
ctggcaatgtaccgcgctaaagatttcgaagacgcggtagaaaaagcagagaaactggta
gctatgggcggtatcggtcatacctcttgcctgtacactgaccaggataaccaaccggct
cgcgtttcttacttcggtcagaaaatgaaaacggctcgtatcctgattaacaccccggct
tctcagggtggtatcggtgacctgtataacttcaaactcgcaccttccctgactctgggt
tgtggttcctggggtggtaactccatctctgaaaacgttggtccgaaacacctgatcaac
aagaaaaccgttgctaagcgagctgaaaacatgttgtggcacaaacttccgaaatctatc
tacttccgccgtggctctctgccaatcgcgctggatgaagtgattactgatggccacaaa
cgtgcgctcatcgtgactgaccgcttcctgttcaacaatggttatgctgatcagatcact
tccgtactgaaagcagcaggcgttgaaactgaagtcttcttcgaagtagaagctgacccg
accctgagcatcgttcgtaaaggtgcagaactggcaaactccttcaaaccagacgtgatt
atcgcgctgggtggtggttccccgatggacgccgcgaagatcatgtgggtcatgtacgaa
catccggaaactcacttcgaagaactggcgctgcgctttatggatatccgtaaacgtatc
tacaagttcccgaaaatgggcgtgaaagcgaaaatgatcgctgtcaccaccacttctggt
acaggttctgaagtcactccgtttgcggttgtaactgacgacgctactggtcagaaatat
ccgctggcagactatgcgctgaccccggatatggcgattgtcgatgccaacctggttatg
gacatgccgaagtccctgtgtgctttcggtggtctggacgcagtaactcacgccatggaa
gcttatgtttctgtactggcatctgagttctctgatggtcaggctctgcaggcgctgaaa
ctgctgaaagaatatctgccagcgtcctaccacgaaggatctaaaaatccggtagcgcgt
gaacgtgttcacagtgcagcaactatcgcgggtatcgcgtttgcgaacgccttcctgggt
gtatgtcactcaatggcgcacaaactgggttcccagttccatattccgcacggtctggca
aacgccctgctgatttgtaacgttattcgctacaacgcgaacgacaacccgaccaagcag
actgcattcagccagtatgaccgtccgcaggctcgccgtcgttatgctgaaattgctgac
cacctgggtctgagcgcaccgggcgaccgtactgctgctaagatcgagaaactgctggca
tggctggaaacgctgaaagctgaactgggtattccgaaatctatccgtgaagctggcgtt
caggaagcagacttcctggcgaatgtggataaactgtctgaagatgcattcgatgaccag
tgcaccggcgctaacccgcgttacccactgatctccgagctgaaacagattctgctggat
acctactacggtcgtgattatgtagaaggtgaaactgcagcgaaaaaagaagccgctccg
gctaaagttgagaaaaaagcgaagaaatccgcttaa

DBGET integrated database retrieval system