KEGG   Escherichia coli O7 K1 IAI39 (ExPEC): ECIAI39_1597Help
Entry
ECIAI39_1597      CDS       T00829                                 

Gene name
trpA
Definition
(RefSeq) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ect  Escherichia coli O7:K1 IAI39 (ExPEC)
Pathway
ect00260  Glycine, serine and threonine metabolism
ect00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ect01100  Metabolic pathways
ect01110  Biosynthesis of secondary metabolites
ect01130  Biosynthesis of antibiotics
ect01230  Biosynthesis of amino acids
Module
ect_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ect00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ECIAI39_1597 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ECIAI39_1597 (trpA)
Enzymes [BR:ect01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ECIAI39_1597 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth
Motif
Other DBs
NCBI-GeneID: 7153488
NCBI-ProteinID: YP_002407596
UniProt: B7NVN0
Structure
PDB: 

Jmol
Position
complement(1665839..1666645)
Genome map
AA seq 268 aa AA seqDB search
MERYESLFIRLKERHEGAFVPFVTLGDPGIEQSLKIIDTLIEAGADALELGIPFSDPLAD
GPTIQNATLRAFAAGVTPAQCFEMLALIRQKHPTIPIGLLMYANLVFNKGVDEFYAQCEK
VGVDSVLVADVPVEESAPFRQAALRHNVAPIFICPPNADDDLLRQIASYGRGYTYLLSRA
GVTGAENRAALPLNHLVTKLKEYNAAPPLQGFGISAPDQVKAAIDAGAAGAISGSAIVKI
IEQHINEPEKMLAALKAFVQPMKAATRS
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggaacgctacgaatctctatttatccgtttgaaggagcgccatgaaggcgcattcgtt
cctttcgtcacgctcggtgatccgggcattgagcagtcgctgaaaattatcgatacgcta
attgaagccggtgctgacgcgctggagttaggtatccccttctccgacccactggcggat
ggcccgaccattcaaaacgccactctgcgcgcctttgcggcaggtgtgactccggcacaa
tgttttgaaatgctggcactgattcgccagaaacacccgaccattcccattggcctgttg
atgtatgccaatctggtgtttaacaaaggcgttgatgagttttatgcccagtgcgaaaaa
gtcggcgtcgattcggtgctggttgccgatgtgccagttgaagagtccgcgcccttccgc
caggccgcgttgcgtcataatgtcgcacctatctttatttgcccgccgaatgccgacgat
gatttgctgcgccagatagcctcctacggtcgtggatacacctatttattgtcacgtgcg
ggcgtgaccggcgcagaaaaccgcgccgcgttacccctcaatcatctggtcacgaagctg
aaagaatacaatgctgcgcctccattgcagggatttggtatttccgccccggatcaggta
aaagcagcgattgatgcaggagctgcgggcgcgatttctggttcggccatcgttaaaatc
atcgagcaacatattaatgagccagagaaaatgctggcggcactgaaagcttttgtacaa
ccgatgaaagcggcgacgcgcagttaa

DBGET integrated database retrieval system