KEGG   Escherichia coli O7 K1 IAI39 (ExPEC): ECIAI39_1599Help
Entry
ECIAI39_1599      CDS       T00829                                 

Gene name
trpC
Definition
(RefSeq) bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
ect  Escherichia coli O7:K1 IAI39 (ExPEC)
Pathway
ect00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ect01100  Metabolic pathways
ect01110  Biosynthesis of secondary metabolites
ect01130  Biosynthesis of antibiotics
ect01230  Biosynthesis of amino acids
Module
ect_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ect00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ECIAI39_1599 (trpC)
Enzymes [BR:ect01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     ECIAI39_1599 (trpC)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     ECIAI39_1599 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI QRPTase_C
Motif
Other DBs
NCBI-GeneID: 7153032
NCBI-ProteinID: YP_002407598
UniProt: A0A0H3MGI6
Structure
PDB: 

Jmol
Position
complement(1667850..1669208)
Genome map
AA seq 452 aa AA seqDB search
MQTVLAKIVADKAIWVETRKEQQPLASFQNEVQPSTRHFYDALQGARTAFILECKKASPS
KGVIRDDFDPARIATVYRNYASAISVLTDEKYFQGSFDFLPIVSQIAPQPILCKDFIIDP
YQIYLARYYQADACLLMLSVLDDEQYRQLAAVAHSLEMGVLTEVSNEEELERAIALGAKV
VGINNRDLRDLSIDLNRTRELAPKLGHNVTVISESGINTYAQVRELSHFANGFLIGSALM
AHDDLNAAVRRVLLGENKVCGLTRGQDAKAAYDAGAIYGGLIFVATSPRCVNVEQAQEVM
AAAPLQYVGVFRNHDIADVVDKAKVLSLAAVQLHGNEDQLYIDTLREALPAHVAIWKALS
VGETLPARDFQHIDKYVFDNGQGGSGQCFDWSLLNGQSLGNVLLAGGLGADNCVEAAQTG
CAGLDFNSAVESQPGIKDARLLASVFQTLRAY
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccgttttagcgaaaatcgtcgcagacaaggcgatttgggtagaaacccgcaaa
gagcagcaaccgctggccagttttcagaatgaggttcagccgagcacgcgacatttttat
gatgcacttcagggcgcacgcacggcgtttattctggagtgtaaaaaagcgtcgccgtca
aaaggcgtgatccgtgatgatttcgatccggcacgcattgcaaccgtctacagaaattac
gcttcggcaatttcggtgctgactgacgagaaatattttcaggggagctttgatttcctc
cccatcgtcagccaaatcgccccgcagccgattttatgtaaagactttattatcgaccct
taccagatctatctggcgcgctattaccaggccgatgcctgcttattaatgctttcagta
ctggatgacgaacaatatcgccagcttgcagccgtcgcccacagtctggagatgggtgtg
ctgaccgaagtcagtaatgaagaggaactggagcgcgccattgcattgggggcaaaggtc
gttggcatcaacaaccgcgatctgcgcgatttgtcgattgatctcaaccgtacccgcgag
cttgcgccgaaactggggcacaacgtgacggtaatcagcgaatccggcatcaatacttac
gctcaggtgcgcgagttaagccacttcgctaacggttttctgattggttcggcgttgatg
gcccatgacgatttgaacgccgccgtgcgccgggtgttgctgggtgagaataaagtgtgt
ggcctgacgcgtgggcaagatgctaaagccgcttatgacgcgggcgcgatttacggtggg
ttgatttttgttgcgacatcaccgcgttgcgtcaacgttgaacaggcgcaggaagtgatg
gctgcggcaccgttgcagtatgttggcgtgttccgcaatcacgatattgccgatgtggtg
gacaaagctaaggtgttatcgctggcggcagtgcaactgcatggtaatgaagatcagctg
tatatcgacactctgcgtgaggctctgccagcacacgtcgccatctggaaggctttaagt
gtcggtgaaactcttcccgcgcgcgattttcagcacatcgataaatatgtattcgacaac
ggtcagggcgggagcggacaatgtttcgactggtcactgttaaacggtcaatcgcttggc
aacgttctgctggcggggggcttaggcgcagataactgcgtggaagcggcacaaaccggc
tgcgccggacttgattttaattctgctgtagagtcgcaaccgggcatcaaagacgcacgt
cttttggcctcggttttccagacgctgcgcgcatattaa

DBGET integrated database retrieval system