KEGG   Escherichia coli O7 K1 IAI39 (ExPEC): ECIAI39_1660Help
Entry
ECIAI39_1660      CDS       T00829                                 

Gene name
ycjM
Definition
putative glucosyltransferase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
ect  Escherichia coli O7:K1 IAI39 (ExPEC)
Pathway
Starch and sucrose metabolism
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ect00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1731832..1733511
Genome map
AA seq 559 aa AA seqDB search
MKQKITDYLDEIYGGTFTATHLQKLVTRLESAKRLITLRRKKHWDESDVVLITYADQFHS
NDLKPLPTFNQFYPQWLQSIFSHVHLLPFYPWSSDDGFSVIDYQQVASEAGEWQDIQQLG
ECSHLMFDFVCNHMSAKSEWFKNYLQQQPGFEDFFIAVDPQTDLSVVTRPRALPLLTPFQ
MRDHSTRHLWTTFSDDQIDLNYRSPEVLLAMVDVLLCYLEKGAEYVRLDAVGFMWKEPGT
SCIHLEKTHLIIKLLRSIIDDVAPGTVIITETNVPHRDNIAYFGNGDDEAHMVYQFSLPP
LVLHAVQKQNVEALCAWAQNLTLPSSNTTWFNFLASHDGIGLNPLRGLLPESEILALVEA
LQQEGALVNWKNNPDGTRSPYEMNVTYMDALNRRESSDEERCARFILAHAILLSFPGVPA
IYIQSILGSRNDYAGVEKLGYNRAINRKKYYSEEITTELNNKTTLRHAVYHELSRLIKIR
RNHNEFHPDNDFTIDTVNSSVMCIQRSNADGNCLTGLFNVSENIQHINITDLHGRDLISE
VDIVGNEITLRPWQVMWIK
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagaaaattacggattacctggacgaaatctacggtggaacatttaccgcaact
catttacagaaacttgtaacgcgtcttgagagtgcgaaacgattaattacactgcgacgt
aaaaaacactgggatgaaagtgatgtcgtgttaatcacctatgccgatcaatttcacagt
aatgatttaaaaccactacccacatttaatcagttttaccctcaatggctgcaaagcatt
ttttcacatgttcatttattacctttttatccatggtcatctgatgatggcttttcggta
attgattatcaacaggtcgccagtgaagcgggggagtggcaggatattcagcaactcggt
gaatgcagtcatttaatgtttgattttgtctgcaaccatatgtcggcaaaaagtgaatgg
tttaaaaactatttacaacagcagccaggttttgaagatttttttattgccgttgacccg
caaaccgatctcagcgtcgtcactcgcccgcgtgcgttaccgttattaacgccattccag
atgcgcgatcattcaacgcgccatttatggaccacctttagtgacgatcaaattgacctg
aattaccgtagccctgaagtgttactggcgatggtggatgtattgctgtgctacctggaa
aagggcgcagaatatgtccgtctggatgccgttggctttatgtggaaagagccgggaaca
agctgcatccatctggaaaaaacacatctgattatcaaactgttacggtcgattattgat
gacgtagcaccaggtacagtgatcattaccgagaccaatgttccgcacagagacaacatt
gcttactttggcaacggtgatgacgaagcgcatatggtgtaccagttctcgctgccgccg
ctggtgctgcatgcggtgcaaaaacagaacgttgaggcgctttgtgcgtgggcgcaaaac
ctgacactaccttccagcaacaccacctggtttaacttcctcgcctctcacgatggcatc
gggcttaacccactgcgtggcttgctacccgaaagcgaaatattagcgctggtcgaggca
ttacagcaggaaggggcattagttaactggaaaaataatcccgacggtacgcgtagcccg
tatgaaatgaatgtcacttatatggatgcgttaaaccgccgcgagagtagcgatgaagaa
cgttgcgccaggtttatccttgcccatgcgattttgttaagtttccccggtgtgccagcg
atatatattcaaagtattctgggctcgcgtaatgattacgcaggtgtcgaaaaactggga
tataaccgtgcgattaaccgtaaaaaatattacagtgaagagatcacgaccgaactgaac
aataaaacgacgttaaggcacgcggtatatcatgaattgtcgcgactaattaaaattcgt
cgaaatcataacgagtttcatccagataatgattttaccatcgacacagttaattcatcc
gtaatgtgtattcaaagaagcaacgcggatggtaattgtctgacaggattgtttaatgtc
agtgaaaatattcagcatataaatattactgacctgcacggtcgggatctgattagtgaa
gttgatatagtgggtaatgaaataacgctgcgcccctggcaggttatgtggattaaataa

DBGET integrated database retrieval system