KEGG   Escherichia coli O7 K1 IAI39 (ExPEC): ECIAI39_1808Help
Entry
ECIAI39_1808      CDS       T00829                                 

Gene name
R
Definition
putative lysozyme protein R of prophage (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
ect  Escherichia coli O7:K1 IAI39 (ExPEC)
Brite
Enzymes [BR:ect01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     ECIAI39_1808 (R)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1895782..1896294)
Genome map
AA seq 170 aa AA seqDB search
MNPSIVKRCLVGTVLAIAATLPGFQQLHTSVEGLKLIADYEGCRLQPYQCSAGVWTDGIG
NTSGVIPGKTITERQAAEGLISNVLRVERALERCVKQQPPQKVYDSVVSFAFNVGTGNAC
SSTLVKLLNQRRWADACRQLPRWVYVKGVFNQGLDNRRAREMAWCLQGAN
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgaatccatcaatcgttaaacgctgccttgtcgggaccgtgctggctattgctgccacg
ctgccgggttttcagcagcttcacacctccgtggagggactgaaactgattgccgattac
gaaggctgtcgtctgcagccctatcagtgcagcgcgggtgtatggactgacggcattggt
aatacgtcgggcgtcattcccggcaaaaccattacggaacgacaggcagcagaagggctt
atctccaacgtgctgcgtgtggagcgggcgctggaaagatgtgtgaagcaacagccgcca
caaaaggtgtatgactcggtggtgtcgtttgccttcaacgtggggacaggcaatgcctgc
agctccacgctggtgaaattgctcaatcagcggcgctgggcggatgcgtgccgacagttg
ccgcgctgggtttatgtaaaaggtgtgtttaatcaggggctggataaccgccgtgcgcgg
gagatggcctggtgtttacagggagcaaactga

DBGET integrated database retrieval system