KEGG   Escherichia coli O7 K1 IAI39 (ExPEC): ECIAI39_2902Help
Entry
ECIAI39_2902      CDS       T00829                                 

Gene name
ascB
Definition
cryptic 6-phospho-beta-glucosidase (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
ect  Escherichia coli O7:K1 IAI39 (ExPEC)
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ect00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3011380..3012804
Genome map
AA seq 474 aa AA seqDB search
MSVFPQGFLWGGALAANQSEGAYREGGKGLTTVDMIPHGEHRMAVKLGLEKRFQLRDDEF
YPSHEATDFYHRYKEDIALMAEMGFKVFRTSIAWSRLFPQGDELTPNQQGIAFYRSVFEE
CKKYGIEPLVTLCHFDVPMHLVTEYGSWRNRKLVEFFSRYARTCFEAFDGLVKYWLTFNE
INIMLHSPFSGAGLVFEEGENQDQVKYQAAHHQLIASALATKIAHEVNPQNQVGCMLAGG
NFYPYSCKPEDVWAALEKDRENLFFIDVQARGAYPAYSARVFREKGVTIDKAPGDDEILK
NTVDFVSFSYYASRCASAEMNANNSSAANVVKSLRNPYLQVSDWGWGIDPLGLRITMNMM
YDRYQKPLFLVENGLGAKDEFAANGEINDDYRISYLREHIRAMGEAIADGIPLMGYTTWG
CIDLVSASTGEMSKRYGFVYVDRDDAGNGTLARTRKKSFWWYKKVIASNGEDLE
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtatttccgcaaggttttttatggggcggcgcgcttgccgccaaccagtctgaa
ggtgcgtaccgtgaaggtggcaaagggctgaccaccgtcgatatgatcccacacggcgag
catcgaatggcggtgaaactgggactggaaaaacgttttcagttgcgtgatgacgagttt
tatcccagccatgaagcgacggatttttatcatcgttataaagaagatatcgccctgatg
gcagagatggggttcaaagtgttccgtacctcaattgcctggagccgtctctttccgcag
ggcgatgaactgacgcccaaccagcagggcattgctttttaccgttctgtctttgaagag
tgtaaaaagtacggtatcgaaccgctggtcacgttgtgccacttcgatgtgccgatgcat
ctggtcaccgaatatggctcctggcgtaaccgcaagctggtggagtttttcagccgctac
gccagaacctgctttgaagcatttgatggtctggtgaaatactggcttaccttcaatgaa
atcaacattatgttgcatagcccgttctccggcgcgggtctggtgtttgaagaaggggaa
aatcaggatcaggtgaaatatcaggctgcgcaccaccagctgattgccagtgcgttagcc
accaaaatcgcccatgaagttaacccgcaaaatcaggtgggctgtatgctggcgggcggt
aacttctacccttacagttgcaagccggaagatgtctgggcggcgctggagaaagatcgg
gaaaacctgttttttatcgatgtgcaggcgcggggcgcgtatccggcttactctgcccgc
gtattccgcgaaaaaggggtaaccatcgacaaagcaccgggcgatgatgagatcctgaaa
aacaccgtcgattttgtctctttcagctattacgcctcgcgctgcgcctcggcggagatg
aacgccaacaatagcagtgcggcgaacgtagtgaaatcgctgcgtaacccgtatctgcaa
gtgagcgactggggctggggtattgatccactcggtctgcgtatcaccatgaatatgatg
tacgaccgttatcagaagccgctgtttctggtggaaaacggcctcggcgcaaaagatgaa
tttgctgccaacggtgagattaacgatgactatcgcatcagctatttacgcgaacatatc
cgcgcaatgggcgaagcgattgcagatggcattccgctgatgggctacaccacatggggc
tgtattgatttagtttccgcctcaacgggtgaaatgagcaaacgctacggttttgtctat
gtagaccgtgacgatgcaggcaacggcacgctggcgcgcacgcgtaagaaatcgttctgg
tggtataaaaaagtaattgccagtaatggtgaggatttagagtaa

DBGET integrated database retrieval system