KEGG   Escherichia coli O7 K1 IAI39 (ExPEC): ECIAI39_3317Help
Entry
ECIAI39_3317      CDS       T00829                                 

Gene name
bglA
Definition
6-phospho-beta-glucosidase A (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
ect  Escherichia coli O7:K1 IAI39 (ExPEC)
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:ect00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECIAI39_3317 (bglA)
Enzymes [BR:ect01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     ECIAI39_3317 (bglA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3470647..3472086
Genome map
AA seq 479 aa AA seqDB search
MIVKKLTLPKDFLWGGAVAAHQVEGGWNKGGKGPSICDVLTGGAHGVPREITKEVLPGKY
YPNHEAVDFYGHYKEDIKLFAEMGFKCFRTSIAWTRIFPKGDEAQPNEEGLKFYDDMIDE
LLKYNIEPVITLSHFEMPLHLVQQYGSWTNRKVVDFFVRFAEVVFERYKHKVKYWMTFNE
INNQRNWRAPLFGYCCSGVVYTEHDNPEETMYQVLHHQFVASALAVKAARRINPEMKVGC
MLAMVPLYPYSCNPDDVMFAQESMRERYVFTDVQLRGYYPSYVLNEWERRGFNIKMEDGD
LDVLREGTCDYLGFSYYMTNAVKAEGGTGDAISGFEGSVPNPYVKASDWGWQIDPVGLRY
ALCELYERYQKPLFIVENGFGAYDKVEEDGSINDDYRIDYLRAHIEEMKKAVTYDGVDLM
GYTPWGCIGCVSFTTGQYSKRYGFIYVNKHDDGTGDMSRSRKKSFSWYKEVIASNGENL
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgatagtgaaaaaactcaccttaccgaaagatttcttatggggcggcgcagttgccgct
catcaggtcgaaggcggctggaacaaaggcggcaaagggccgagcatttgtgacgttctg
accggtggcgcacacggtgtgccgcgcgaaatcaccaaagaagtcttgccaggcaaatac
tatccgaaccatgaagccgttgatttttatggtcactacaaggaggacatcaagctattt
gccgaaatgggcttcaaatgttttcgtacttccatcgcctggacgcgcatttttccaaaa
ggcgatgaagctcagccaaacgaagaagggctgaagttctacgatgatatgatcgatgaa
ctgctgaaatacaacatcgaaccggtgatcaccctctcccactttgaaatgccgctgcat
ctggtgcagcaatacggtagctggaccaaccgtaaagtggttgatttctttgtccgtttc
gcagaagtggtatttgaacgctataagcataaagtcaaatactggatgaccttcaacgaa
attaacaaccagcgtaactggcgtgcaccgctgttcggttactgctgctccggcgtggtg
tataccgagcatgataacccggaagagacgatgtaccaggtgctgcatcaccagtttgtc
gccagcgccctggcggtgaaagccgcgcgtcgcattaacccggaaatgaaagtcggctgt
atgctggcgatggtgccgctttacccttactcctgtaatccggacgatgtgatgttcgct
caggagtcgatgcgcgaacgctacgtctttaccgatgtgcagctacgcggctattacccg
tcctatgtgttgaacgagtgggagcgtcgcggatttaacatcaaaatggaagatggcgat
ctggatgtactgcgtgaaggcacctgcgattatcttggtttcagctattacatgaccaac
gcagtgaaggccgaaggcggtaccggcgatgcgatctctggttttgaaggcagcgtaccg
aatccgtatgttaaagcgtctgactggggctggcagattgatcctgtgggtctgcgttac
gcactttgcgaactgtatgagcgttatcagaagccgctgtttattgtcgaaaacggtttt
ggcgcttatgacaaagtggaagaagatggcagcatcaacgacgactaccgcattgactac
ctgcgcgcccatattgaagagatgaaaaaagcggtgacttacgatggcgtggatctgatg
ggctacacaccgtggggctgcatcggctgtgtgtcgtttaccaccgggcagtacagcaaa
cgctacggctttatctatgtgaataaacatgacgacggtactggcgatatgtcgcgttca
cgtaagaagagctttagctggtacaaagaggtgattgccagcaacggcgagaatctgtaa

DBGET integrated database retrieval system