KEGG   Escherichia coli O7 K1 IAI39 (ExPEC): ECIAI39_3356Help
Entry
ECIAI39_3356      CDS       T00829                                 

Gene name
speB
Definition
(RefSeq) agmatinase
  KO
K01480  agmatinase [EC:3.5.3.11]
Organism
ect  Escherichia coli O7:K1 IAI39 (ExPEC)
Pathway
ect00330  Arginine and proline metabolism
ect01100  Metabolic pathways
Module
ect_M00133  Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:ect00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    ECIAI39_3356 (speB)
Enzymes [BR:ect01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     ECIAI39_3356 (speB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase UPF0489
Motif
Other DBs
NCBI-GeneID: 7153983
NCBI-ProteinID: YP_002409277
UniProt: B7NI01
Position
complement(3512743..3513663)
Genome map
AA seq 306 aa AA seqDB search
MSTLGHQYDNSLVSNAFGFLRLPMNFQPYDSDADWVITGVPFDMATSGRAGGRHGPAAIR
QVSTNLAWEHNRFPWNFDMRERLNVVDCGDLVYAFGDAREMSEKLQAHAEKLLAAGKRML
SFGGDHFVTLPLLRAHAKHFGKMALVHFDAHTDTYANGCEFDHGTMFYTAPKEGLIDPNH
SVQIGIRTEFDKDNGFTVLDACQVNDRGVDDVIAQVKQIVGDMPVYLTFDIDCLDPAFAP
GTGTPVIGGLTSDRAIKLVRGLKDLNIVGMDVVEVAPAYDQSEITALAAATLALEMLYIQ
AAKKGE
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccttaggtcatcaatacgataactcactggtttccaacgcctttggtttttta
cgcctgccgatgaacttccagccgtatgacagcgatgctgactgggtaattaccggcgtg
ccgttcgatatggccacttctggtcgtgcgggtggacgccacggtccggcggcgatccgt
caggtttcgacgaatctggcctgggaacacaaccgcttcccgtggaatttcgacatgcgc
gagcgtctgaacgtggtggactgcggcgatctggtgtatgccttcggcgatgctcgtgag
atgagcgagaagctgcaggcgcatgccgaaaagctgctggctgccggtaagcgtatgctc
tccttcggtggtgaccactttgttaccctgccgctgctgcgtgctcatgcgaagcatttc
ggcaaaatggcgctggtacactttgacgcccacaccgatacctatgcgaacggttgtgaa
tttgaccacggcaccatgttctataccgcgccgaaagaaggtctgatcgacccgaatcac
tccgtacagattggtattcgtaccgagtttgataaagacaacggctttaccgtactggac
gcctgccaggtgaacgatcgcggcgtggatgacgttatcgcccaagtgaaacagattgtg
ggtgatatgccggtttacctgacctttgatatcgactgcctggatcctgctttcgcgccg
ggaaccggtacgccagtaattggcggcctgacctccgatcgcgctattaaactggtacgc
ggcctgaaagatctcaacattgttgggatggacgtagtggaagtggctccggcatacgat
cagtcggaaatcaccgctctggctgcggcgacgctggcgctggaaatgctgtatatccag
gcggcgaaaaagggcgagtaa

DBGET integrated database retrieval system