KEGG   Escherichia coli O7 K1 IAI39 (ExPEC): ECIAI39_3574Help
Entry
ECIAI39_3574      CDS       T00829                                 

Gene name
ebgA
Definition
cryptic beta-D-galactosidase subunit alpha (EC:3.2.1.23)
Orthology
K12111  
evolved beta-galactosidase subunit alpha [EC:3.2.1.23]
Organism
ect  Escherichia coli O7:K1 IAI39 (ExPEC)
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ect00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    ECIAI39_3574 (ebgA)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    ECIAI39_3574 (ebgA)
Enzymes [BR:ect01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     ECIAI39_3574 (ebgA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3729815..3732907
Genome map
AA seq 1030 aa AA seqDB search
MNRWENIQLTHENRLAPRAYFFSYDSVAQARTFARETSSLFLPLSGQWNFHFFDHPLQVP
EAFTSELMADWGHITVPAMWQMEGHGKLQYTDEGFPFPIDVPFVPSDNPTGAYQRIFTLS
DGWQGKQTLIKFDGVETYFEVYVNGQYVGFSKGSRLTAEFDISAMVKTGDNLLCVRVMQW
ADSTYVEDQDMWWSAGIFRDVYLVGKQLTHINDFSVRTDFDEAYCDATLSCEVVLENLAA
SPVVTTLEYTLFDGERVVHSSAIDHLAIEKLTSASFAFTVEQPQQWSAESPYLYHLVMTL
KDADGNVLEVVPQRVGFRDIKVRDGLFWINNRYVMLHGVNRHDNDHRKGRAVGMDRVEKD
LQLMKQHNINSVRTAHYPNDPRFYELCDIYGLFVMAETDVESHGFANVGDISRVTDDPQW
EKVYVERIVRHIHAQKNHPSIIIWSLGNESGYGCNIRAMYHAVKALDDTRLVHYEEDRDA
EVVDIISTMYTRVPLMNEFGEYPHPKPRIICEYAHAMGNGPGGLTEYQNVFYKHDCIQGH
YVWEWCDHGIQAQDDNGNVWYKFGGDYGDYPNNYNFCLDGLIYSDQTPGPGLKEYKQVIA
PVKIHALDLTRGELKVENKLWFTTLDDYTLHAEVRAEGETLATQQIKLRDVAPNSEAPLQ
ITLPQLDAREAFLNITVTKDSRTRYSEAGHSIATYQFPLKENTAQPVPFAPNNARPLTLE
DDRLSCTVRGYNFAITFSKMSGKPTSWQVNGESLLTREPKINFFKPMIDNHKQEYEGLWQ
PNHLQIMQEHLRDFAVEQSDGEVLIISRTVIAPPVFDFGMRCTYIWRIAADGQVNVALSG
ERYGDYPHIIPCIGFTMGINGEYDQVAYYGRGPGENYADSQQANIIDIWRSTVDAMFENY
PFPQNNGNRQHVRWTALTNRHGNGLLVVPQRPINFSAWHYTQENIHAAQHCNELQRSDDI
TLNLDHQLLGLGSNSWGSEVLDSWRVWFRDFSYGFTLLPVSGGEATAQSLASYEFGAGFF
STNLHSENKQ
NT seq 3093 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgctgggaaaacattcagctcacccacgaaaaccgacttgcgccgcgtgcgtac
tttttttcatatgattctgttgcgcaagcgcgtacctttgcccgcgaaaccagcagcctg
tttctgcccttaagcggtcagtggaatttccatttttttgaccacccgctgcaagtgcct
gaagccttcacctctgagttaatggctgactgggggcatattaccgtccccgccatgtgg
caaatggaaggtcacggcaaactgcaatataccgacgaaggttttccgttccccatcgat
gtgccgtttgtccccagcgataacccaaccggtgcctatcaacgtattttcaccctcagc
gacggctggcagggtaaacagacgctgattaaatttgacggcgtcgaaacctattttgaa
gtctatgttaacggtcagtatgtgggtttcagcaagggcagtcgcctgaccgcagagttt
gacatcagcgcgatggttaaaaccggcgacaacctgttgtgtgtgcgcgtgatgcagtgg
gcggactctacctacgtggaagaccaggatatgtggtggtcagcggggatcttccgcgat
gtttatctggtcggaaaacaactaacgcatattaacgatttctccgtgcgtaccgacttt
gacgaagcctattgcgatgccacgctttcctgcgaagtggtgctggaaaatctcgccgcc
tcccctgtcgtaacgacgctggaatataccctgtttgatggcgaacgcgtggtgcacagc
agcgccattgatcatttggcaattgaaaaactgaccagcgccagctttgcttttactgtc
gaacagccgcagcaatggtcagcagaatccccttacctttaccatctggtcatgacgctg
aaagacgccgacggcaacgttctggaagtggtaccacaacgcgttggcttccgtgatatc
aaagtgcgcgacggtctgttctggatcaataaccgttatgtgatgctgcacggcgtcaac
cgtcacgacaacgatcatcgcaaaggccgcgccgttggaatggatcgcgtcgagaaagat
ctccagttgatgaagcagcacaacatcaactccgtgcgtaccgctcactacccgaacgat
ccgcgtttttacgaactgtgtgatatctacggcttgtttgtgatggcggaaaccgacgtc
gaatcgcacggctttgctaatgtcggcgatatcagccgtgttaccgacgatccgcagtgg
gaaaaagtctacgtcgagcgcattgttcgccatatccacgcgcagaaaaaccatccgtcg
atcatcatctggtcgctgggcaatgaatccggctatggctgtaacatccgcgcgatgtac
catgcggtgaaagcgctggatgacacgcgactggtgcattacgaagaagatcgcgatgct
gaagtggtcgatattatttccaccatgtacacccgcgtgccgctgatgaatgagtttggt
gaatacccgcatccgaagccgcgcatcatctgtgaatatgctcatgcgatggggaacgga
ccgggcgggctgacggagtaccagaacgtcttctataagcacgattgtattcagggacat
tatgtttgggagtggtgcgaccacggaatccaggcgcaggatgacaacggcaatgtctgg
tataaattcggcggcgactacggcgactatcccaacaactataacttctgtcttgatggt
ttgatctattccgatcagacgccgggaccgggcctgaaagagtacaaacaggttatcgcg
ccggtaaaaatccacgcgctggatctgactcgcggcgagctgaaagtcgaaaataaactg
tggtttaccacgcttgatgactacaccctgcacgcagaggtgcgcgccgaaggtgaaacg
ctcgcaacgcagcagattaaactgcgcgacgttgcgccgaacagcgaagcccccttgcag
atcacgctgccgcagctggacgcccgcgaagcgttcctcaacattacggtgaccaaagat
tcccgcacccgctacagcgaagccgggcattctatcgccacttatcagttcccgctgaag
gaaaacaccgcgcagccagtgcctttcgcaccaaataatgcgcgtccgctgacgctggaa
gacgatcgtttgagctgcaccgttcgcggctacaacttcgcgatcaccttctcaaaaatg
agtggcaaaccgacatcctggcaggtaaatggcgagtcgctgctgactcgcgagccaaag
atcaacttcttcaagccgatgatcgacaaccacaagcaggagtacgaagggctgtggcaa
ccgaatcatttgcagatcatgcaggaacatctgcgcgactttgccgtagaacagagcgat
ggtgaagtgttgatcatcagccgcacggttattgccccgccggtgtttgatttcggaatg
cgctgcacctacatctggcgcatcgctgccgatggccaggttaacgtggcgctttccggc
gagcgttacggcgactatccgcacatcattccgtgcatcggtttcaccatgggaattaac
ggcgaatacgatcaggtggcgtattacggtcgtggaccgggcgaaaactacgccgacagc
cagcaggctaacatcatcgatatctggcgcagcaccgtcgatgccatgttcgagaactat
cccttcccgcagaacaacggtaaccgtcagcatgtccgctggacggcactgactaaccgc
cacggtaacggtctgctggtggttccgcagcgcccaattaacttcagcgcctggcactat
acccaggaaaacatccacgctgcccagcactgtaacgagctgcagcgcagtgatgacatc
accctgaacctcgatcaccagctgcttggcctcggctccaactcctggggcagcgaggtg
ctggactcctggcgcgtctggttccgtgacttcagctacggctttacgttgctgccggtt
tctggcggagaagctaccgcgcaaagcctggcgtcgtatgagttcggcgcagggttcttt
tccacgaatttgcacagcgagaataagcaatga

  All links  
No link information was found.   
DBGET integrated database retrieval system