KEGG   Escherichia coli O7 K1 IAI39 (ExPEC): ECIAI39_4357Help
Entry
ECIAI39_4357      CDS       T00829                                 

Gene name
rbsK
Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
ect  Escherichia coli O7:K1 IAI39 (ExPEC)
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ect00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    ECIAI39_4357 (rbsK)
Enzymes [BR:ect01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     ECIAI39_4357 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4542202..4543131
Genome map
AA seq 309 aa AA seqDB search
MQNAGSLVVLGSINADHILNLQSFPTPGETVTGNHYQVAFGGKGANQAVAAGRSGANIAF
IACTGDDSIGESVRQQLATDNIDISPVSVIKGESTGVALIFVNGEGENVIGIHAGANAAL
SPALVEAQRERIANASALLMQLESPLESVMAAAKIAHQNKTIVALNPAPARELPDELLAL
VDIITPNETEAEKLTGIRVENDEDAAKAAQVLHEKGIRTVLITLGSRGVWASVNGEGQRV
PGFRVQAVDTIAAGDTFNGALITALLEEKTLPEAIRFAHAAAAIAVTRKGAQPSVPWREE
IDAFLDRQR
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaacgcaggcagcctcgttgttcttggcagcattaatgctgaccacattcttaat
cttcaatcttttcctactccaggcgaaaccgtaaccggtaaccactatcaggttgcattt
ggcggcaaaggcgctaatcaggctgtggctgctgggcgtagcggtgcgaatatcgcgttt
attgcctgtacgggtgatgacagtattggtgagagcgttcgccagcagctcgccactgat
aacattgatatttctccggtcagcgtgatcaaaggcgaatcaacaggtgtggcgctgatt
tttgttaatggcgaaggtgagaatgtcattggtattcatgccggcgctaatgctgccctt
tcccctgcgctggtggaagcgcaacgtgagcgtattgccaacgcgtcagcattattaatg
cagctggaatcaccactcgaaagtgtgatggcagcggcgaaaatcgcccatcaaaataag
actatcgttgcgcttaacccggctccggctcgcgaacttcctgacgaactgctggcactg
gtggacattattacgccaaacgaaacggaagcagaaaagctcaccggtattcgtgttgaa
aatgatgaagatgcagcgaaagcggcgcaggtactgcatgaaaaaggtatccgtactgta
ctgattactttaggaagtcgtggtgtatgggctagcgtgaatggtgaaggtcagcgcgtt
cctggattccgggtgcaggctgtcgataccattgctgccggagatacttttaacggcgcg
ttaatcacggcgttgctggaagaaaaaacattgccagaggcgattcgttttgcccatgcc
gccgctgcgattgccgtaacacgtaaaggcgcacaaccttccgtaccgtggcgtgaagag
atcgacgcatttttagacaggcagaggtga

DBGET integrated database retrieval system