KEGG   Escherichia coli O7 K1 IAI39 (ExPEC): ECIAI39_4400Help
Entry
ECIAI39_4400      CDS       T00829                                 

Gene name
aceB
Definition
(RefSeq) malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
ect  Escherichia coli O7:K1 IAI39 (ExPEC)
Pathway
ect00620  Pyruvate metabolism
ect00630  Glyoxylate and dicarboxylate metabolism
ect01100  Metabolic pathways
ect01110  Biosynthesis of secondary metabolites
ect01120  Microbial metabolism in diverse environments
ect01200  Carbon metabolism
Module
ect_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ect00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ECIAI39_4400 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    ECIAI39_4400 (aceB)
Enzymes [BR:ect01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     ECIAI39_4400 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-GeneID: 7152050
NCBI-ProteinID: YP_002410274
UniProt: A0A0H3MMT1
Structure
PDB: 

Jmol
Position
4600231..4601832
Genome map
AA seq 533 aa AA seqDB search
MTEQATTTDELAFIRPYGEQEKQILTAEAVEFLTELVTHFTPQRNKLLAARIQQQQDIDN
GTLPDFISETASISGADWKIRGIPADLQDRRVEITGPVERKMVINALNANVKVFMADFED
SLAPDWNKVIDGQINLRDAVNGTISYTNEAGKIYQLKPNPAVLICRVRGLHLPEKHVTWR
GEAIPGSLFDFALYFFHNYQALLAKGSGPYFYLPKTQSWQEAAWWSEVFSYAEDRFNLPR
GTIKATLLIETLPAVFQMDEILHALRDHIVGLNCGRWDYIFSYIKTLKNYPDRVLPDRQA
VTMDKPFLNAYSRLLIKTCHKRGAFAMGGMAAFIPSKDEERNNQVLNKVKADKALEANNG
HDGTWIAHPGLADTAMAVFNDILGSRKNQLEVMREQDAPITADQLLAPCDGERTEEGMRA
NIRVAVQYIEAWISGNGCVPIYGLMEDAATAEISRTSIWQWIHHQKTLSNGKPVTKALFR
QMLGEEMKVIASELGEERFSQGRFDDAARLMEQITTSDELIDFLTLPGYRLLA
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgactgaacaggcaacaacaaccgatgaactggctttcataaggccgtatggcgagcag
gagaagcaaattcttactgccgaagcggtagaatttctgactgagctggtgacgcatttt
acgccacaacgcaataaacttctggcagcgcgcattcagcagcagcaggatatcgataac
ggaacgttgcctgattttatttcggaaacagcttccattagtggtgctgactggaaaatt
cgtggtattcccgcggacttacaagatcgtcgagtcgagataactggcccggttgagcgc
aagatggtgatcaacgcgctcaacgccaatgtgaaagtctttatggccgatttcgaagat
tcactggccccggactggaacaaagtgatcgacgggcaaattaacctgcgcgatgcggtt
aacggcaccatcagctataccaatgaagcaggcaaaatttatcagctcaagcccaatcca
gcggtgttgatttgtcgggttcgcggtctgcacttgccggaaaaacatgtcacctggcgc
ggcgaagcaattcctggcagcctgtttgattttgcgctctatttcttccacaactaccag
gctctgttagcaaaaggcagcggtccctatttctatctgccgaaaacccagtcctggcag
gaagcggcctggtggagcgaagtcttcagctatgcagaagatcgctttaatctgccgcgc
ggcaccatcaaggcgacgttgctgattgaaacgctgcccgccgtgttccagatggacgaa
atccttcacgcgctgcgtgaccatattgttggtctgaactgcggtcgttgggattacatc
ttcagttatatcaaaacgttgaaaaactatcccgatcgcgtcctgccagatagacaggca
gtgacgatggataaacccttcctgaatgcttactcacgcctgttgattaaaacctgccat
aaacgcggtgcttttgcgatgggcggtatggcggcatttattccgagcaaagatgaagag
cgcaataaccaggtgctcaacaaagtaaaagcggataaagcgctggaagccaataacggt
cacgatggcacatggatcgctcacccaggccttgcggatacggcaatggcggtattcaac
gacattctcggctcccgtaaaaatcagcttgaagtgatgcgcgaacaagacgcgccgatt
actgccgatcagctgctggcaccttgtgatggtgaacgcaccgaagaaggtatgcgcgcc
aacattcgcgtggctgtgcagtacatcgaagcatggatctccggcaacggctgcgtgccg
atttatggcctgatggaagatgcggcgacggctgaaatttcccgtacctcaatctggcag
tggatccatcatcaaaaaacgttgagcaatggcaaaccggtgaccaaagccttgttccgc
cagatgctgggcgaagagatgaaagtcattgccagcgaactgggcgaagaacgtttctcc
caggggcgttttgacgatgccgcacgcttgatggaacagatcaccacttccgatgagtta
attgatttcctgaccctgccaggctaccgcctgttagcgtaa

DBGET integrated database retrieval system