KEGG   Escherichia coli O7 K1 IAI39 (ExPEC): ECIAI39_4843Help
Entry
ECIAI39_4843      CDS       T00829                                 

Gene name
holD
Definition
DNA polymerase III subunit psi (EC:2.7.7.7)
Orthology
K02344  
DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
ect  Escherichia coli O7:K1 IAI39 (ExPEC)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:ect00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    ECIAI39_4843 (holD)
   00240 Pyrimidine metabolism
    ECIAI39_4843 (holD)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    ECIAI39_4843 (holD)
   03430 Mismatch repair
    ECIAI39_4843 (holD)
   03440 Homologous recombination
    ECIAI39_4843 (holD)
Enzymes [BR:ect01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     ECIAI39_4843 (holD)
DNA replication proteins [BR:ect03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     ECIAI39_4843 (holD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
5050185..5050598
Genome map
AA seq 137 aa AA seqDB search
MTSRRDWQLQQLGITQWSLRRPGALQGEIAIAIPPHVRLVMVANDLPALTDPLVSDVLRA
LTVSPDQVLQLTPEKIAMLPQGSRCNSWRLGTDEPLSLEGAQVASPALTELRANPTARAA
LWQQICTYEHDFFPRND
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgacatcccgacgagactggcagttacagcaactgggcattacccagtggtcgctgcgt
cgccctggcgcgttgcagggggagattgccattgcgatcccgccacacgtccgtctggtg
atggtggcaaacgatcttcccgccctgaccgatcctctggtgagcgatgttctgcgtgcg
ttaaccgtcagccccgatcaagtgctgcaactgacgccagaaaaaatcgcgatgctgccg
caaggcagtcgctgcaacagctggcggttgggtactgacgaaccgctatcactggaaggc
gctcaggtggcatcaccggcgctcaccgaattacgggcaaacccaacggcacgcgccgcg
ttatggcaacaaatttgcacatatgaacacgatttcttccctcgaaacgactga

DBGET integrated database retrieval system