KEGG   Encephalitozoon cuniculi: ECU01_0670Help
Entry
ECU01_0670        CDS       T00105                                 

Definition
hypothetical protein
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
ecu  Encephalitozoon cuniculi
Pathway
Basal transcription factors
Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:ecu00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    ECU01_0670
  Replication and repair
   03420 Nucleotide excision repair
    ECU01_0670
Transcription machinery [BR:ecu03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     ECU01_0670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:83991..85235
Genome map
AA seq 414 aa AA seqDB search
MPSEVSQAWPYPIDIIEYFEMLPRHSKTQLYGAPIFAVSFLKVFDEKTTKFVFDLLLKSH
SISSLREIEGIKETLKILLRIQVIGKKGNNIYLDEGFRRSLMDGFCMLTMERHYRSIGEK
VEMDESESSRKFEAILGSVVNRECRIEAFGVSEVLMFGGLLGRDRNITNRGFEFLLKTKK
EQLWCLVLLSLKYFLGSVEEEIAVLEALFELSARAVGTVYRQVDQMDRRLFKYLEALGIL
RLYEKGLAIGRSFVQLFEASERNRREFIIVETNNKIYAYTNSEYEKSVIHLFCNVTVNLP
NLIKGIITEESVNVAFDKGITGKQIIHFLEASVRQGSLPPAIRNQIVIWESKRNRIFMVP
GYLYSNFLNLSDYQKVLEFCIRGNHLVESDVDKRMIVVKLEGHSLVKEFVKTIL
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgccaagcgaagtctcccaagcatggccatatccaatagacatcatcgaatacttcgaa
atgcttccgagacactcgaagacacagctgtatggagcgccgatctttgcagtgtcgttt
cttaaggtctttgacgagaagaccacaaaatttgtcttcgacctactactgaagtctcac
tccataagctcgctaagggagatagagggaatcaaggagactttgaagatactgctaagg
atccaggtgatcggaaagaaaggaaacaacatatatctggatgagggtttcagaaggtcg
ttaatggacgggttttgcatgcttacgatggaaaggcactacaggagcattggtgagaag
gtggaaatggatgagtcggaaagcagcagaaaatttgaggctattctggggtctgtcgtc
aacagggagtgcaggatagaggcgtttggggtctcggaggttcttatgtttggagggctc
cttggcagggacagaaacattaccaacagaggatttgagtttcttctgaagacaaaaaag
gagcagctgtggtgtcttgtgcttctatccctgaagtactttctcgggtctgtggaagag
gagatagctgtgcttgaggcgctgtttgagctaagcgcaagggccgttggaactgtgtat
cgccaggtcgaccagatggacaggagactgtttaagtacttggaggcgctgggaatactg
aggctttatgaaaaaggtcttgcaattggaagatcctttgtacagctgttcgaggcatcg
gagcgcaacaggagggagtttataatagtggagacgaacaacaagatatatgcatacaca
aactccgaatacgaaaagtctgtaatacatttgttctgcaatgtgactgtcaatcttccg
aacctgatcaagggaatcataacggaggagagcgtgaatgttgcattcgacaagggaata
accggaaagcagataatccattttttggaggcaagtgtcagacaaggaagcctgcccccg
gcaattaggaaccagatagtgatatgggagtcgaagagaaacaggattttcatggtgcct
ggatacctgtattcgaacttcctgaatctgtcagactatcagaaggtactagaattctgc
attagaggaaaccacctggtggaatcggatgttgacaaaagaatgatagttgtgaagctg
gaggggcatagcctcgttaaggagttcgtaaagactatactctag

DBGET integrated database retrieval system