KEGG   Encephalitozoon cuniculi: ECU01_1220Help
Entry
ECU01_1220        CDS       T00105                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
ecu  Encephalitozoon cuniculi
Pathway
Purine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecu00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    ECU01_1220
Enzymes [BR:ecu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     ECU01_1220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(145900..146553)
Genome map
AA seq 217 aa AA seqDB search
MTSTMMGSTNKWISCFLQRVTWDTYFVLLIFMPMIDGVHLVLTGPSGSGKSTIISHVLSK
FPFEFSVSHTTRAPRNGEVNGKDYFFVTTEEFESMVERQELLEYIQYNGNYYGTAAAQLR
NPSKTVILDLEYDGVLYCRKNCPNFVIIYIYCDKNIAYERLKKRMGSENKKELEGRMRLY
EKFDSIKDRCDYVIDNSHSLEKSKREVEEIISKTFRF
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgacatcaacgatgatgggctctacgaataaatggattagttgttttctgcaacgcgta
acctgggacacctactttgtcctccttatttttatgcccatgattgacggtgttcaccta
gtgcttactgggcctagcggatctgggaagtctaccattataagccacgtcctgtcgaag
tttccgttcgagttttcggtgtcccacacgaccagggcacctagaaatggagaggtgaat
gggaaagattacttctttgtaacaacagaagaatttgagtcgatggtagagaggcaggag
ctgcttgagtatatccagtacaacggtaactactatggaacagcagcagctcagctgagg
aacccctcgaagactgttatactggatttggagtacgatggcgttctgtactgccggaag
aattgcccaaactttgtcattatatacatctactgtgacaagaacattgcctacgaaagg
ttgaaaaagaggatggggagtgaaaacaagaaggagctggaggggcggatgaggctgtac
gaaaaatttgattcaattaaggatagatgtgactatgtcatcgacaatagccattccctt
gagaaatctaaaagggaagttgaggagatcatatccaagacattccgattctag

DBGET integrated database retrieval system