KEGG   Encephalitozoon cuniculi: ECU02_0440Help
Entry
ECU02_0440        CDS       T00105                                 

Definition
GLUTATHION PEROXIDASE
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
ecu  Encephalitozoon cuniculi
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:ecu00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    ECU02_0440
  Metabolism of other amino acids
   00480 Glutathione metabolism
    ECU02_0440
Enzymes [BR:ecu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     ECU02_0440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:51413..51946
Genome map
AA seq 177 aa AA seqDB search
MERGMESEAFYGLSARGWDGSEVSLGSFRGCVIMIANVASSCKFAESNYKSFAGLLDKFY
RKGLRILLFPCNQYLGQESRPIEEIRGEVSKKYSDRFVVFDKVDVFGKGAHPVFRHLVNT
KNGKGRLGNFIKWNFTKFLVDRKGCVVKRFGPSDIVKEDDENLLRSIEDGENGMQNS
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atggagcgagggatggaatcagaggccttttacggtctgagtgctcgtggatgggacgga
agcgaagtcagccttggatcgttcagagggtgcgttattatgattgctaatgttgcgtcg
tcatgcaagtttgctgaaagcaactacaagagctttgcgggtcttcttgataagttctac
aggaaagggctaaggattcttttgtttccctgcaatcagtatctgggccaggagtcaagg
cccattgaggaaatacgcggagaggtgtctaagaagtattcggacaggtttgtggttttt
gacaaagtcgatgtttttgggaaaggagctcatcccgtgttcaggcatcttgtcaatacc
aaaaacggaaaggggaggctcggaaatttcattaagtggaactttacaaaattcctcgtt
gatcgtaagggatgtgttgttaagaggtttgggccaagcgatattgtcaaggaggatgac
gagaatctcttgaggagtattgaggatggggagaatggcatgcagaactcctga

DBGET integrated database retrieval system