KEGG   Encephalitozoon cuniculi: ECU02_0510Help
Entry
ECU02_0510        CDS       T00105                                 

Definition
MPS1-LIKE THR/TYR DUAL SPECIFICITY PROTEIN KINASE
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
ecu  Encephalitozoon cuniculi
Pathway
Cell cycle - yeast
Class
Cellular Processes; Cell growth and death; Cell cycle - yeast [PATH:ecu04111]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:59351..61111
Genome map
AA seq 586 aa AA seqDB search
MEGIFNSKSLYEYLEEQKQAGISKTKEISLYYKATSKSVGDDEYSLRIWLDYIRLLMDGT
KDVTEARETFKMIKMRFCKFYNYWEAYVRFEIEAGNGSLCKILQHSIDFVKVKEFTEKKR
VLEYLECVMSYARNGEDLSVFCRGPETSFKPGAQVLSPFEARIGEQSKNKVLKKEHEESG
PGHRDDGKNLLSRSGRAHLAPDECKENDNKNRAREDGASLSPSFAAKSKNCGATFGTIPI
RFEKEDYSQGITMEINAALGRTSPEGSNSSPRSGAVRSRERIIIKGREIEILKQIGKGGS
SKVYKVLFGSNVYALKRVELIGDEKMLSSYINEINLLYKFKGTSEIVEIIDHEVGEDYLH
ILLEYGETDLSKIIRKGGLSMNFIKDVWEQMLLIVKRVHIERIIHCDLKPANFLFVKGRV
KLIDFGISKVIRNDTTSILSEEQCGTVNYMSPEAVTQNKSKVARSSDIWSLGCILYEMVH
SNPPLHEYPNLIQKIQRLQEYSEFKYTSKNKAAVMVMKECLARDPKKRPTIDNLLNHRFL
TGEMCLESLRELVEKILKIDGGDRVDPEHVDRIAEQLHSTHRQDQA
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atggaggggattttcaacagcaagagtctttatgagtatctcgaggagcagaagcaagcg
ggcatatcaaagaccaaggagatatctctgtattacaaggcaacatcaaagagtgtgggt
gacgacgagtattcgctaagaatatggctggactacatccggctactcatggacgggaca
aaggatgtgacggaggccagagagacattcaagatgataaagatgaggttctgcaagttc
tacaactactgggaggcctatgtccgatttgagattgaggctggaaacgggagtctctgt
aagatcttgcagcacagcattgattttgtcaaggtcaaggagttcaccgaaaagaagaga
gtgctggagtatttagagtgtgtgatgtcctatgcccgaaatggagaggacctgtctgta
ttttgcagaggccccgagacgagctttaagccaggtgctcaggtcctcagtccttttgag
gccaggatcggagaacaatcgaaaaacaaggttttgaaaaaagagcacgaggagtcaggg
cctgggcatagagacgatggaaagaacctcttgtccaggagcggcagggcccatctcgca
cccgatgaatgcaaggagaacgacaacaagaacagagctcgggaagatggagcgtctctg
tcgcctagtttcgcggcgaagtccaaaaattgtggggccacttttggaacgatacccatt
aggtttgagaaggaagactactctcagggaataacgatggaaataaatgcagccttgggg
aggacaagccccgagggaagcaactcatccccaaggtccggggcagtgcgatccagagag
aggataataatcaaaggaagagagatcgagattctcaagcagatagggaagggaggaagt
agtaaggtgtacaaggttctttttgggagcaacgtgtatgccttgaaaagagtcgagctg
attggagatgaaaagatgctcagctcctacattaacgaaataaacctactgtataagttc
aaagggacatcggagatagtcgagattatagaccacgaggtgggtgaagactacctacac
atcctactggaatatggagagacggacctgtcgaagatcataaggaaaggaggcttaagc
atgaacttcatcaaggatgtatgggagcaaatgcttctgatagtaaagagggttcacatt
gaaaggattattcactgcgatcttaaaccagcaaactttctgtttgtcaagggacgcgtc
aagctcatagacttcggaatatccaaggtcataagaaatgacacaaccagcattttgtcc
gaggagcaatgcgggactgtaaactacatgtcgccagaggctgtcactcagaacaagtcc
aaagttgcccgtagctctgacatctggtctctgggatgcattttgtatgagatggtccac
tcgaatcctcccttgcacgagtaccccaatctgatccagaagatacagaggctccaggag
tactccgagtttaagtacacaagcaagaacaaggctgcagtcatggttatgaaggaatgt
ttagccagagacccgaagaagcggccgaccatagataatctccttaaccacaggtttctt
actggggaaatgtgtctggaatctcttcgggagttagtcgaaaagatccttaaaatcgat
ggaggagacagagtcgatcctgagcatgttgacaggatagctgagcagcttcactccact
cataggcaggaccaggcgtga

DBGET integrated database retrieval system