KEGG   Encephalitozoon cuniculi: ECU02_0510Help
Entry
ECU02_0510        CDS       T00105                                 

Definition
MPS1-LIKE THR/TYR DUAL SPECIFICITY PROTEIN KINASE
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
ecu  Encephalitozoon cuniculi
Pathway
Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:ecu00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    ECU02_0510
Enzymes [BR:ecu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     ECU02_0510
Protein kinases [BR:ecu01001]
 Serine/threonine protein kinases: Other group
  TTK family
   ECU02_0510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:59351..61111
Genome map
AA seq 586 aa AA seqDB search
MEGIFNSKSLYEYLEEQKQAGISKTKEISLYYKATSKSVGDDEYSLRIWLDYIRLLMDGT
KDVTEARETFKMIKMRFCKFYNYWEAYVRFEIEAGNGSLCKILQHSIDFVKVKEFTEKKR
VLEYLECVMSYARNGEDLSVFCRGPETSFKPGAQVLSPFEARIGEQSKNKVLKKEHEESG
PGHRDDGKNLLSRSGRAHLAPDECKENDNKNRAREDGASLSPSFAAKSKNCGATFGTIPI
RFEKEDYSQGITMEINAALGRTSPEGSNSSPRSGAVRSRERIIIKGREIEILKQIGKGGS
SKVYKVLFGSNVYALKRVELIGDEKMLSSYINEINLLYKFKGTSEIVEIIDHEVGEDYLH
ILLEYGETDLSKIIRKGGLSMNFIKDVWEQMLLIVKRVHIERIIHCDLKPANFLFVKGRV
KLIDFGISKVIRNDTTSILSEEQCGTVNYMSPEAVTQNKSKVARSSDIWSLGCILYEMVH
SNPPLHEYPNLIQKIQRLQEYSEFKYTSKNKAAVMVMKECLARDPKKRPTIDNLLNHRFL
TGEMCLESLRELVEKILKIDGGDRVDPEHVDRIAEQLHSTHRQDQA
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atggaggggattttcaacagcaagagtctttatgagtatctcgaggagcagaagcaagcg
ggcatatcaaagaccaaggagatatctctgtattacaaggcaacatcaaagagtgtgggt
gacgacgagtattcgctaagaatatggctggactacatccggctactcatggacgggaca
aaggatgtgacggaggccagagagacattcaagatgataaagatgaggttctgcaagttc
tacaactactgggaggcctatgtccgatttgagattgaggctggaaacgggagtctctgt
aagatcttgcagcacagcattgattttgtcaaggtcaaggagttcaccgaaaagaagaga
gtgctggagtatttagagtgtgtgatgtcctatgcccgaaatggagaggacctgtctgta
ttttgcagaggccccgagacgagctttaagccaggtgctcaggtcctcagtccttttgag
gccaggatcggagaacaatcgaaaaacaaggttttgaaaaaagagcacgaggagtcaggg
cctgggcatagagacgatggaaagaacctcttgtccaggagcggcagggcccatctcgca
cccgatgaatgcaaggagaacgacaacaagaacagagctcgggaagatggagcgtctctg
tcgcctagtttcgcggcgaagtccaaaaattgtggggccacttttggaacgatacccatt
aggtttgagaaggaagactactctcagggaataacgatggaaataaatgcagccttgggg
aggacaagccccgagggaagcaactcatccccaaggtccggggcagtgcgatccagagag
aggataataatcaaaggaagagagatcgagattctcaagcagatagggaagggaggaagt
agtaaggtgtacaaggttctttttgggagcaacgtgtatgccttgaaaagagtcgagctg
attggagatgaaaagatgctcagctcctacattaacgaaataaacctactgtataagttc
aaagggacatcggagatagtcgagattatagaccacgaggtgggtgaagactacctacac
atcctactggaatatggagagacggacctgtcgaagatcataaggaaaggaggcttaagc
atgaacttcatcaaggatgtatgggagcaaatgcttctgatagtaaagagggttcacatt
gaaaggattattcactgcgatcttaaaccagcaaactttctgtttgtcaagggacgcgtc
aagctcatagacttcggaatatccaaggtcataagaaatgacacaaccagcattttgtcc
gaggagcaatgcgggactgtaaactacatgtcgccagaggctgtcactcagaacaagtcc
aaagttgcccgtagctctgacatctggtctctgggatgcattttgtatgagatggtccac
tcgaatcctcccttgcacgagtaccccaatctgatccagaagatacagaggctccaggag
tactccgagtttaagtacacaagcaagaacaaggctgcagtcatggttatgaaggaatgt
ttagccagagacccgaagaagcggccgaccatagataatctccttaaccacaggtttctt
actggggaaatgtgtctggaatctcttcgggagttagtcgaaaagatccttaaaatcgat
ggaggagacagagtcgatcctgagcatgttgacaggatagctgagcagcttcactccact
cataggcaggaccaggcgtga

DBGET integrated database retrieval system