KEGG   Encephalitozoon cuniculi: ECU02_1300Help
Entry
ECU02_1300        CDS       T00105                                 

Definition
DOLICHOL-PHOSPHATE MANNOSE PROTEIN MANNOSYLTRANSFERASE
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
ecu  Encephalitozoon cuniculi
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:ecu00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    ECU02_1300
Enzymes [BR:ecu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose---protein mannosyltransferase
     ECU02_1300
Glycosyltransferases [BR:ecu01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   ECU02_1300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(154668..156683)
Genome map
AA seq 671 aa AA seqDB search
MMRKTKYLEISTTLLIFMLSIVIKTYKIENGDFVIWDEAHFGKFSEKYLSRKFYFDVHPP
LGKILTSLGGYLFNQPLDFEFKSGEKFPPGFDYSGMRRFHSIIASFTPVFGYLMLKEMRY
SYRRRLLLSMVFLFENGFTSIGRLILLDSHLLTFTAAVAYFMTRVYFRSRKTIHLPSVFL
LGLTLGCVLSIKWIGFLTMGLVGIFTVYQLWCNAISKESILVLVKLFFMKAFFLIGIPAS
LYVLLFYVHFEIVNRSGSDDGHMSSLFQASLKGSSIGNNRKYPLFGTKITIKSAKTGGGY
LHSHNHKYPDGGNNQVTIYHHKDENNEWLFQKVTDDLEDAEFIESGDTVVLLHMETRKYL
DIPGTHSLISRGLRAESSGNHLSETNLFKIEVVDDALEKESRIKTLTTRFRLLNIKHNCY
LGPSSRKYPSWGFEQGEVICTTKKDEATLWNVEENNSDKLSKERNPVYREIARYPFIRKF
VEHNKAMFITNASFVQDEDLEPERIVSRPYEWLILRRGLRMTSWDGRTEKFYMFGNPLIW
YSSGVCVILSPVILLSRIIRQRRRGKPLAFLRGEGYIVFLSCCGWLLHYIPFFFVKRVLY
FHHYYPALFFALFSLCYVMKFVRLRLVAVFVSAAITSFFLYSRLTYGFAEETEFLRRISI
IPTWDFIEKEQ
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atgatgaggaagacaaaatacctcgagatctccacaactctcctgatattcatgctgagt
atagtcataaaaacctacaaaatagaaaacggagactttgttatttgggatgaagcccac
tttggaaagttttccgaaaagtatttgtccagaaagttctatttcgatgtccatcctccc
ttggggaagatactgacctcacttggggggtatctcttcaaccagccactggactttgaa
ttcaaatccggcgagaaatttcctccagggtttgattattctgggatgcgaagatttcat
tctattatagcatcctttacacccgtcttcggatatcttatgcttaaggagatgaggtac
tcgtacaggcgtaggctgcttctgtccatggtgtttctatttgaaaatggatttacatcc
attggaaggctgatacttctggactcacaccttttgacatttacggctgcagtagcgtat
tttatgaccagagtgtattttaggtccagaaagacgatacatcttccttctgtgtttctc
ttaggcctgactttagggtgtgtgctgagcattaagtggataggatttcttactatgggg
ttggttggaatatttacagtttaccagctgtggtgcaatgccatctcgaaagaaagcatt
cttgtgcttgtgaaactattcttcatgaaagcgttctttctgatcggcatcccagcatct
ctgtatgttctcctattctatgttcacttcgagatagtcaacagaagtgggagcgacgat
gggcatatgagctcacttttccaggcaagtcttaaaggcagcagcattggcaacaacagg
aaatatcctctgttcggtacaaagataacaatcaagtctgctaagaccgggggaggatat
ctccactctcacaaccacaagtatccagacggcggaaacaaccaggtgacgatttaccat
cacaaggatgaaaacaatgagtggctgttccagaaggtgactgacgacttagaggatgcc
gagtttatagaatctggagatacggtagttctattgcacatggagacaaggaagtattta
gacattccgggcacccattctctcatctcgaggggactgagggcagagtcttcaggaaac
catctttccgaaacaaatctgtttaagattgaagtagtggacgacgctttagagaaagag
agcaggataaaaacccttaccaccagattcagactgctaaacattaagcacaactgctat
cttggaccctcttctagaaaatatccctcatgggggtttgagcagggggaggtcatctgc
accacaaaaaaggacgaagctactctctggaatgtcgaagaaaacaattctgataagcta
agcaaggaaaggaatcctgtgtacagagagatcgcaagatatccatttatcaggaagttt
gtggagcataacaaggccatgtttattacaaacgcctcttttgtccaggacgaggatctg
gagccggagagaattgtttcaaggccgtatgaatggcttattctcagaaggggactaaga
atgacttcatgggacgggcggaccgagaagttctacatgtttggaaacccgctcatatgg
tattcgtcaggggtctgtgtgattctttctccggtgattcttctctccagaatcattagg
cagaggcggaggggaaagcccttggcatttctgaggggtgagggctacatagtcttctta
tcctgttgtggatggctcctccattatatccccttcttctttgttaagagagtattgtac
ttccaccattactatcctgccctcttttttgcactgttttctctgtgctatgttatgaag
tttgtacgactcaggcttgtggctgtgtttgtatccgctgcaatcacatccttttttctc
tactccaggctaacatatggatttgcagaggaaaccgaatttcttagaagaattagcata
atccccacctgggactttatagagaaggaacaataa

DBGET integrated database retrieval system