KEGG   Encephalitozoon cuniculi: ECU03_0280Help
Entry
ECU03_0280        CDS       T00105                                 

Definition
UTP GLUCOSE 1 PHOSPHATE URIDYLTRANSFERASE 1
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ecu  Encephalitozoon cuniculi
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ecu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ECU03_0280
   00052 Galactose metabolism
    ECU03_0280
   00500 Starch and sucrose metabolism
    ECU03_0280
   00520 Amino sugar and nucleotide sugar metabolism
    ECU03_0280
Enzymes [BR:ecu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     ECU03_0280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
III:complement(32199..33677)
Genome map
AA seq 492 aa AA seqDB search
MQESRSKESTLSGDEDKDVHRFLDEFDDKCTCKLLKEMKETLEGLKKSHPNPTNLDEFYR
LFERYLRTRHEKIVWEKIRSPKDRIVQYNEIPEPTEKSKELLRKLAILKLNGGLGTTMGC
VGPKSAITIKDGKNFIDLVVKQIRYLNSKYKIDVPLILMNSFNTEGMTDKIIFRYDGIKK
FSQSKFPRISSETLLPVSPSHGDKGMYPPGHGDLFYSMKNSGMLEELLEGGYEYLFVSNI
DNLASTVDLKLLEYFATNELGFLMEVTDKTRADVKGGTLIEYKGALRLLEIAQVPSNKKS
EFTSFKKFTIFNTNNLWINLKEMKKKLEEGFFDLDIIENKKALDDETVIQLETAIGSAIK
YFPNSCGVVVPRSRFLPVKTCSDLFLVESNLFVEKNGTLQLHPSRVPETCPTVKLIGENF
SKIEKYEKCFKGIPDILELEVLTVSGNVLFGKNVVLKGTVIILADEKSKICVPDGSVLED
NIIYGNLPIIDH
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaaagtagaagtaaggaatcgacgctttctggcgatgaagataaagatgttcat
agattcttggatgagtttgacgacaaatgcacctgcaagcttctgaaggaaatgaaggaa
acactggaagggctgaagaaaagtcatccaaatccgacgaacttggacgagttctaccgt
ctgtttgaaagatatcttagaacaaggcacgaaaagatagtatgggaaaaaatcaggtcg
ccgaaagacaggattgttcagtacaacgagataccggagccgacggaaaagtccaaggag
ctgctgaggaaactggcaatactaaaactcaacggaggacttggaacgacaatgggctgt
gtcgggccaaagagcgccataacaattaaggatggcaagaacttcatagatctagttgtg
aagcagatcaggtatctgaattccaagtacaaaatagacgttccactaatactgatgaac
tcgtttaacacagaaggcatgacagacaaaattatatttagatacgatggaatcaagaag
ttctcccaaagcaagttcccaaggatctcatcggaaacattactccctgtatcaccttca
cacggagataaagggatgtatccgccaggccatggagacctgttctactcgatgaagaac
agcggaatgctcgaggagcttctggaaggaggatatgaatatctcttcgtatccaatatt
gataacctggcctccacagttgacttgaagctcctggagtattttgcaaccaacgaattg
gggtttctgatggaggttaccgacaaaacgcgtgcagacgtcaagggagggactctgata
gaatacaaaggagctcttcggcttctcgaaatagcccaggttccatcaaacaagaaatcg
gagttcacaagcttcaagaagttcacgatattcaacacaaataacctttggatcaacctt
aaggagatgaagaaaaagctagaagaaggcttctttgatctggatatcattgagaacaaa
aaggccctggatgacgagacggtcatccagctggaaactgccataggatccgcaatcaaa
tactttcctaactcttgtggagttgtcgttccgaggtctagattccttccggtgaaaaca
tgttccgacctgtttcttgttgaaagcaacctctttgtcgaaaagaacgggacgctgcag
ctccatccgtccagggttccagagacatgtcctacagtcaagcttattggagagaacttc
tcgaagatagaaaaatacgagaagtgctttaaggggattccagacattcttgagctggag
gttctgacggttagtggcaatgttctgtttggaaagaatgttgttctcaagggaacagtt
attatactggcagacgaaaaaagtaagatctgtgttcctgatgggtctgtgctagaggat
aacattatatacggcaatcttcctattatagaccattaa

  All links  
No link information was found.   
DBGET integrated database retrieval system