KEGG   Encephalitozoon cuniculi: ECU03_0580Help
Entry
ECU03_0580        CDS       T00105                                 

Definition
UBIQUITIN CARBOXY-TERMINAL HYDROLASE
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.1.2.15]
Organism
ecu  Encephalitozoon cuniculi
Brite
Enzymes [BR:ecu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     ECU03_0580
Peptidases [BR:ecu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   ECU03_0580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
III:75113..77914
Genome map
AA seq 933 aa AA seqDB search
MDEGWKVKRPSSGAKVESKPFSVQGHTWKLILSNRCNRVYLALEYQGGSYHDILTAFCFD
IDGKKYEYQYQFSMFSTDIGMYIEEKERYVIRVDVRVRTGCYNSKEETGYVGLRNLGATC
YINSLMQALFSIAKFRNDVFGLEPRGRVLLLQKLFKEMQTGEHPVDTTDFVVNNIWVDDV
HVHQDIHEFSKVFFDSLEKDSKRKDVIEDMIQGELVTYINGKCGCVRRIKEKFQDIQVEI
RDFFNNKLSSNLQESLKRYVKSEILDGNNRYNCEKHGLVDAKKGVMFSSLPPVMFILLKR
FNVDFETGNGYKINDYFEFPDSIDMLPFLDRDSKRKEESDATYDLYSVIVHRGDHDEGHF
YAYLKINGRWLKFNDTVVTEAGEMEALEHNFGGRHPYKDRIRDHSGYYLIYLRKSMANDL
LNAKVVIPPRTEEVLSRKQDKTLVRCIRIDNIRNYRGIGFYNIDSYDYPLSSYAEFVMKE
GDTIKLLRNNIEKHLSTRKSLYLFECTRIKSHEKGETSDRPCKRVKEDTRELVGTNTRTV
EEEASRIIEHVQLDYQRKVALVKDGVINVSADYFVYTCHPGVNFEGHRLIFLKVFNSIPW
CEDTLPTSLRLCACVHMDGTIGDNIDVIGEKTGLDDIAVFREFDFSSALDPSTKISDLPQ
GDVLVAVRRENVLEFLDFIGDFYRRLCVNVSCGPHNFTIFVKRGLKSTELEDRIRRFVGS
KEIFLRKEAVSDSSEFRTAPEDSVQSDPEPDLHEYLQPRNSVSCFISAGYQVVYLAFCNK
EMDYNAVPHLHILVTKVGCTSLELIKSVLVSRFVCLNPVRGHSLKTLRIVDTVRDTLYLK
AFAMSEEFTTNGMCVIQPFVRRAIKTAYYTGMYKIVGFPFFLQADVETVTEFRKKYKLFG
KMVMFDGKSYTDLELDWPMSKFNDECFLLIERT
NT seq 2802 nt NT seq  +upstreamnt  +downstreamnt
atggatgagggttggaaagtcaagaggccgtctagcggggcaaaggtggagtccaagccg
ttttctgtgcaggggcatacctggaagctgattctgtcgaacaggtgcaacagggtgtac
ttggcgctggaataccaagggggatcctatcatgacatcctaacagcattttgttttgac
attgatgggaagaaatatgaatatcagtaccagttttcgatgttcagcacagacatcggg
atgtatattgaggagaaggagaggtatgtgatcagggttgatgtccgtgtaaggaccggg
tgctacaactcgaaggaggagaccggatatgtcgggcttcggaatcttggggcaacgtgc
tacatcaactccttgatgcaggccctgttcagcatagccaagttcaggaatgacgtgttt
gggctagagcccagaggaagagtcctgcttctccagaagctgtttaaggagatgcagacg
ggagagcatcctgtggacacaacagactttgttgtgaataacatatgggtggacgatgtc
catgtccaccaggatatccacgagttttcgaaggtttttttcgactctcttgagaaggac
agcaagaggaaggacgttatcgaggacatgatacagggagagctggtgacatatataaac
ggaaagtgcggatgtgtgaggaggataaaggaaaagttccaggacatccaagtggagatc
cgggacttcttcaacaacaagctatcgtcgaatctgcaggagtctctgaaaagatatgta
aagagtgagattctcgatgggaacaacaggtacaactgcgagaagcacgggcttgttgat
gcgaagaagggtgtgatgttcagttctcttcccccggttatgtttattcttttgaagagg
ttcaatgttgactttgagacaggaaatgggtacaagataaacgactactttgagttcccc
gattcgattgatatgctaccgtttctggacagggactctaagagaaaggaggaatctgac
gcgacgtatgatctgtactctgtcatagtgcataggggagaccacgatgaaggccatttc
tatgcatacctgaaaatcaatggaagatggctcaagttcaacgacactgttgtgaccgag
gctggggagatggaggcactggagcacaactttggaggaagacatccttataaggacagg
atacgagaccattctggatattacctgatctacctcaggaaaagtatggccaacgatctg
ttgaatgcgaaggttgtaatccccccgagaacggaggaggtgctgagcagaaagcaggac
aagactctggtcaggtgcataagaatagacaacatcaggaactacaggggaattgggttt
tacaacatcgactcatacgactatcctctgagcagctatgccgagtttgtcatgaaggag
ggagataccatcaagctgctaaggaacaacattgaaaagcacctcagcacccggaagtct
ttgtatttatttgagtgtaccaggataaagagccatgaaaagggtgagacatctgacaga
ccctgtaagagggttaaggaagacacgcgtgagttggtagggacaaatacaaggactgtg
gaggaggaggcatccaggatcattgagcatgttcaactcgactatcaaagaaaagtcgcc
ctcgtgaaggatggagttattaatgtcagtgcagactacttcgtctacacatgccatcca
ggggttaatttcgaggggcacaggcttatattccttaaggtcttcaacagcattccctgg
tgtgaagacacgctgcccacatctctacgactctgtgcatgtgtgcacatggatggaacc
atcggggacaacatagacgttattggtgagaagacagggcttgatgacattgcagtgttc
agagagtttgacttctcgtctgcgctggacccatccaccaagatttctgaccttccccag
ggagatgtcttggttgcagtcagaagagagaacgtcttggagttccttgacttcataggg
gacttctaccggaggctatgcgtgaatgtttcctgtgggccccacaactttaccatattt
gtgaaaagaggtctgaaaagcactgagcttgaggacaggatccggcggtttgtcgggtcg
aaagaaatatttctgcggaaggaggctgtttctgacagctccgagttcaggacggcacca
gaggactctgtccagtcggatccggagcctgatcttcatgaatacctgcagcccaggaat
tctgtgtcatgcttcatcagcgctggatatcaagtagtctatctagcattctgcaacaag
gagatggactacaatgccgtccctcacctgcacatccttgtgactaaggttgggtgcacg
tccttggagctgatcaagagtgttcttgtgtcccgctttgtatgcctcaatcctgtgaga
gggcactcgttgaagaccctgagaatagtcgacacggtccgggacacactgtatctcaag
gcgtttgcgatgtccgaggagtttactaccaacgggatgtgtgttatccagccgtttgta
aggagggccatcaaaacggcatattacaccgggatgtacaagatagtggggtttccgttc
ttcctgcaggctgatgtggaaaccgttacagagttcagaaagaaatacaagttatttgga
aagatggtgatgttcgatggaaagagctacaccgacctggagcttgactggccgatgagc
aaattcaacgacgaatgctttcttctaattgaaaggacataa

DBGET integrated database retrieval system