KEGG   Encephalitozoon cuniculi: ECU03_0660Help
Entry
ECU03_0660        CDS       T00105                                 

Definition
UBIQUITIN CARBOXY-TERMINAL HYDROLASE 14
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.4.19.12]
Organism
ecu  Encephalitozoon cuniculi
Brite
Enzymes [BR:ecu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     ECU03_0660
Peptidases [BR:ecu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   ECU03_0660
Exosome [BR:ecu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   ECU03_0660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
III:83547..85283
Genome map
AA seq 578 aa AA seqDB search
MGLPNLSRFREKCCYCYRSIGDGISVCDCGFSFCEKHRGIHLGKSGCRIVFDIKEVGSDL
GIEIKNAMLGEEEVEELRRRMEILIKPGDEDERVLSRDEEVRCVHGCPEGPSSIEMGNIG
GLKCNLCDVKTRLWVCFSCGYVGCGRMQYGAEGNGHAKSHYEETQHNVFVLVPSLLKEDC
EIFCYLCDSNIRSRYNSAENSVTIDFGGADGKTEERSVRKVMSCRGIAEPEFLEKKRAPE
SKGESVPSPYVGIINSGNTCYISSVIHMVGYAVSKEEFDLEQHFEICYMKNPLECFFCQL
MRVLSKMKETKDNEGVNRISILDLIMLIWRDMPMFGKFAQQDAHEFLLFLLEKIREGERS
YLIPPITSLFEFEVGRRVSCSGCMDDSTSYESMLMICTFLKGNIRKSVEMFFLPDEWSCE
CGGKKKVSRFITTLPKYLIIQVGRYSYNNYKVEKIKDKIEMRSIKLGSFMSKDEADRSLV
RKLVDSGYPEEDAAKALGIFWNDESKARSLLENHAMMDMRTDSKYRVVGCINHSGDNIKA
GHYTWWVYDNGKCFKIDDTTVLNSNVEVLEDGYIFLFK
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atgggattaccgaatctctctagattcagagaaaagtgctgctactgctacagaagcatt
ggggacgggatatctgtgtgcgactgtggcttctcgttctgtgagaagcacagaggtatt
catcttgggaagagtggatgccgtattgtatttgatatcaaggaggtcggcagcgaccta
gggatagaaattaagaatgcaatgcttggggaggaggaggttgaggagttaaggagaagg
atggagatactgattaagcctggagatgaagatgaaagggttctttccagagacgaggag
gtaaggtgcgttcatggatgtcctgaagggccgagctcgatagagatggggaacattgga
ggccttaagtgcaacctgtgtgatgtaaagacgaggctctgggtctgtttcagttgcggg
tatgtcggctgtgggaggatgcagtatggcgcggaaggaaatggacatgcaaagtcccac
tacgaggaaacgcagcacaatgtttttgttctggtgcccagccttcttaaggaagactgt
gagatattttgctacctctgcgactcgaatataaggtctcggtacaactctgcagaaaat
agtgttacgatagactttggaggtgccgacggaaagacagaggaaaggagtgtaagaaag
gtgatgagctgcaggggcatcgctgagcctgagtttctggagaaaaaaagggcccctgag
agcaagggggagtctgtccccagcccgtatgtcgggatcatcaattcggggaatacctgc
tacatttcgtctgtcattcatatggtagggtatgctgtttccaaagaggagtttgatctt
gagcagcatttcgagatatgttacatgaagaatcccttggaatgctttttctgccagctg
atgagagtgctcagcaaaatgaaggagactaaggacaacgaaggagtcaacaggatatcg
attctggaccttatcatgcttatatggagagacatgcccatgttcggcaagtttgcacag
caggatgcccacgagttcctgctatttctgcttgaaaaaatccgcgagggtgagcgttcg
tacctgattccgccgataacgtctctctttgagtttgaggttgggagaagggtttcgtgc
tcggggtgcatggatgactctaccagctatgagtccatgttgatgatatgcaccttcctg
aagggaaacataagaaagtctgtagagatgtttttcctcccggatgagtggagctgtgag
tgtggaggaaagaaaaaggtaagccggtttatcacgacgctgccgaagtatctaataatt
caggttggaagatactcatacaacaattacaaggtggagaagatcaaggacaagatcgag
atgaggagcatcaagctggggagcttcatgagcaaagacgaggcagacaggtctcttgta
aggaagcttgtggacagcggatacccggaagaagatgcagcgaaggccctgggcatcttt
tggaacgacgagagtaaggcccgcagccttcttgagaaccatgccatgatggacatgagg
acggactcaaagtacagagttgttgggtgtatcaatcattctggagacaatatcaaggct
gggcactatacgtggtgggtgtacgacaacgggaagtgcttcaagatagacgacacaact
gtcctcaatagcaatgttgaggtgttagaagatgggtatatattcctgttcaagtaa

DBGET integrated database retrieval system