KEGG   Encephalitozoon cuniculi: ECU03_0660Help
Entry
ECU03_0660        CDS       T00105                                 

Definition
UBIQUITIN CARBOXY-TERMINAL HYDROLASE 14
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
ecu  Encephalitozoon cuniculi
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
III:83547..85283
Genome map
AA seq 578 aa AA seqDB search
MGLPNLSRFREKCCYCYRSIGDGISVCDCGFSFCEKHRGIHLGKSGCRIVFDIKEVGSDL
GIEIKNAMLGEEEVEELRRRMEILIKPGDEDERVLSRDEEVRCVHGCPEGPSSIEMGNIG
GLKCNLCDVKTRLWVCFSCGYVGCGRMQYGAEGNGHAKSHYEETQHNVFVLVPSLLKEDC
EIFCYLCDSNIRSRYNSAENSVTIDFGGADGKTEERSVRKVMSCRGIAEPEFLEKKRAPE
SKGESVPSPYVGIINSGNTCYISSVIHMVGYAVSKEEFDLEQHFEICYMKNPLECFFCQL
MRVLSKMKETKDNEGVNRISILDLIMLIWRDMPMFGKFAQQDAHEFLLFLLEKIREGERS
YLIPPITSLFEFEVGRRVSCSGCMDDSTSYESMLMICTFLKGNIRKSVEMFFLPDEWSCE
CGGKKKVSRFITTLPKYLIIQVGRYSYNNYKVEKIKDKIEMRSIKLGSFMSKDEADRSLV
RKLVDSGYPEEDAAKALGIFWNDESKARSLLENHAMMDMRTDSKYRVVGCINHSGDNIKA
GHYTWWVYDNGKCFKIDDTTVLNSNVEVLEDGYIFLFK
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atgggattaccgaatctctctagattcagagaaaagtgctgctactgctacagaagcatt
ggggacgggatatctgtgtgcgactgtggcttctcgttctgtgagaagcacagaggtatt
catcttgggaagagtggatgccgtattgtatttgatatcaaggaggtcggcagcgaccta
gggatagaaattaagaatgcaatgcttggggaggaggaggttgaggagttaaggagaagg
atggagatactgattaagcctggagatgaagatgaaagggttctttccagagacgaggag
gtaaggtgcgttcatggatgtcctgaagggccgagctcgatagagatggggaacattgga
ggccttaagtgcaacctgtgtgatgtaaagacgaggctctgggtctgtttcagttgcggg
tatgtcggctgtgggaggatgcagtatggcgcggaaggaaatggacatgcaaagtcccac
tacgaggaaacgcagcacaatgtttttgttctggtgcccagccttcttaaggaagactgt
gagatattttgctacctctgcgactcgaatataaggtctcggtacaactctgcagaaaat
agtgttacgatagactttggaggtgccgacggaaagacagaggaaaggagtgtaagaaag
gtgatgagctgcaggggcatcgctgagcctgagtttctggagaaaaaaagggcccctgag
agcaagggggagtctgtccccagcccgtatgtcgggatcatcaattcggggaatacctgc
tacatttcgtctgtcattcatatggtagggtatgctgtttccaaagaggagtttgatctt
gagcagcatttcgagatatgttacatgaagaatcccttggaatgctttttctgccagctg
atgagagtgctcagcaaaatgaaggagactaaggacaacgaaggagtcaacaggatatcg
attctggaccttatcatgcttatatggagagacatgcccatgttcggcaagtttgcacag
caggatgcccacgagttcctgctatttctgcttgaaaaaatccgcgagggtgagcgttcg
tacctgattccgccgataacgtctctctttgagtttgaggttgggagaagggtttcgtgc
tcggggtgcatggatgactctaccagctatgagtccatgttgatgatatgcaccttcctg
aagggaaacataagaaagtctgtagagatgtttttcctcccggatgagtggagctgtgag
tgtggaggaaagaaaaaggtaagccggtttatcacgacgctgccgaagtatctaataatt
caggttggaagatactcatacaacaattacaaggtggagaagatcaaggacaagatcgag
atgaggagcatcaagctggggagcttcatgagcaaagacgaggcagacaggtctcttgta
aggaagcttgtggacagcggatacccggaagaagatgcagcgaaggccctgggcatcttt
tggaacgacgagagtaaggcccgcagccttcttgagaaccatgccatgatggacatgagg
acggactcaaagtacagagttgttgggtgtatcaatcattctggagacaatatcaaggct
gggcactatacgtggtgggtgtacgacaacgggaagtgcttcaagatagacgacacaact
gtcctcaatagcaatgttgaggtgttagaagatgggtatatattcctgttcaagtaa

DBGET integrated database retrieval system