KEGG   Encephalitozoon cuniculi: ECU03_0680Help
Entry
ECU03_0680        CDS       T00105                                 

Definition
(RefSeq) 6-PHOSPHOFRUCTOKINASE (PHOSPHOFRUCTO-1-KINASE ISOENZYME A)
  KO
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ecu  Encephalitozoon cuniculi
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ecu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ECU03_0680
   01230 Biosynthesis of amino acids
    ECU03_0680
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECU03_0680
   00030 Pentose phosphate pathway
    ECU03_0680
   00051 Fructose and mannose metabolism
    ECU03_0680
   00052 Galactose metabolism
    ECU03_0680
  Energy metabolism
   00680 Methane metabolism
    ECU03_0680
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    ECU03_0680
Enzymes [BR:ecu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     ECU03_0680
Protein phosphatases and associated proteins [BR:ecu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     ECU03_0680
Messenger RNA biogenesis [BR:ecu03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     ECU03_0680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
III:complement(86105..88870)
Genome map
AA seq 921 aa AA seqDB search
MIGYRGDKCNLWRKDMQAVIEELLLSGDGISQKHGEVYELLGLDVIYDRGTLKIYSTRRA
KIVSISSGIHVHVSYKVLSHLITRGLVNEDGHGTSLEIVDMMGNKIVATFVGHEKMNRIA
IVTSGGDAPGMNSAIKSIIRTGIKWGASVYGVYNGYDGLINNSIRRLSWDTETYCSSQGG
TVLLSARSLKFREKDGRKLAVLNMVRKRINCMVILGGDGSMEGAAILRDEFKGHLRELIR
EGKISARDLQKMRISRIGLEKGSEEKEQPITDGSGVSYSDFYGKPECYKENPVVHDLNSS
DDVSEDLQADVCLGENTGPDDVEKYVYGLKIVGIPSTIDNDIWGAPVSLGEDTAIHRVVE
AIDHLMSTMKSHSRTFVIEVMGRRCGWIALMSSLASAADYALLPEAPAEWRVEMIETLRI
AKKCGKSGIFVIVAEGAVEKDGTPISASQVVEEIDRAGMEVRLLKLGHIQRGGPTSAQDR
IYGTLLGIRAVEILLGPMRDPVMISIFRDEVSEVELKKVIEKNRAIKSLQERRMFDEILR
NRSNFFRLAYSYFRKSLVGVESAGGCVCNSKKGHEVEHRRGQDPCPDTFSGKVRIGIMQF
GQRSSGMNAALNAAVQYSLMVGAEPFYIPNGFEGLVNSQLIRPRLYEFSSDVNNGGSAIG
VGSNEEVDAGLIQKKLDESKLDSLIVIGGSKALHIIKELRGVSIVLIPASSYNNIPGIDI
SIGADTALNAVLKVSDVSKLNSFAYKNNVFVVEIGGGNCGYLSLMGGIAAGAFEVFIPER
KYLIGHLSEAAQRLRMKFREKTRRGIVIFRNERTFRSISTKSFCEILKTDSGDLFETDYS
ILGHIQQGQNPSPIDRINAAILGIEAIDLCRQKCGIGVLGFSEDRIKFTKIEEVLKEFDH
ELDREKNPYWLKYSGICRSVE
NT seq 2766 nt NT seq  +upstreamnt  +downstreamnt
atgattggttacagaggagataaatgtaatctctggaggaaggatatgcaggctgttatt
gaggagctgctgctgtctggagatgggatatcgcagaagcacggagaggtgtatgagctc
cttgggctggacgtgatatacgacagggggacgctgaagatttacagcactaggagggcc
aagatagtgtccataagctctggaatccatgtgcatgtttcgtacaaggtactgagccac
ctgataacccgggggcttgtcaacgaggacggacacggaacgtctctggagatagtggac
atgatggggaacaagattgtggccacgtttgtggggcacgagaagatgaacaggattgcg
attgtaacgagcgggggagatgctccagggatgaactctgcaatcaagagcataatcagg
accggaataaagtggggagcatcggtgtatggagtatacaatggatatgatgggcttatc
aacaacagcatacgcagactcagctgggacaccgagacctactgcagcagccaagggggg
actgttctcctgtctgcaaggtccctgaagttccgggagaaggatgggaggaagctggcc
gtgctgaacatggtccgaaagaggatcaactgtatggtaatcctggggggtgacgggtct
atggagggtgctgcaatccttagagatgaatttaagggtcatctgagggagcttatacgg
gaaggaaagatttcggcaagggacctccagaagatgaggatcagtaggatagggctagaa
aagggatccgaggaaaaggagcagccaatcacagacggaagtggcgtcagctactctgac
ttctatgggaagccggagtgctacaaggaaaatccagtggtgcatgaccttaactcgtcc
gacgacgtttctgaggatctccaagcagacgtctgtctgggtgagaacacaggtccagat
gatgtcgagaagtatgtctatggcctgaagattgtggggattccatcgaccatagacaac
gacatctggggggctcccgtttctttaggagaggacactgcaatccacagggttgtcgag
gcaatagaccacttgatgtccaccatgaagtcgcattcgcgcacgtttgtcattgaggtc
atgggccggagatgcggatggatagctcttatgtcttccctggcaagtgcagcagactat
gccttgcttcctgaggcgcctgccgagtggagagtggagatgattgaaacgcttagaatt
gcaaagaagtgtgggaagtctgggatatttgtcatcgttgcagaaggggctgttgaaaag
gatggaacacccatatccgcgtcccaggttgtggaggagattgacagggcggggatggaa
gtcaggcttcttaagctgggccatatccagaggggagggccgacctctgcgcaggatagg
atatacggcacccttcttggaatcagggctgtcgagatattgctaggccccatgagagat
cctgtgatgatcagcatcttcagagacgaggtctcggaggttgagctgaagaaggtgata
gagaagaacagggccatcaagagccttcaggagaggaggatgtttgacgagatactgaga
aacagaagtaacttcttcaggttagcttactcgtattttagaaaatcgctggtaggagtg
gaaagtgcaggaggctgtgtctgcaattccaagaaggggcatgaggtcgagcataggcgt
ggccaggatccttgtccagacaccttcagtgggaaggtccgcataggaataatgcagttt
gggcagcgatccagtggtatgaatgcggcactgaatgcagcagtccaatactctctaatg
gtaggggctgagcccttctacatcccaaatggatttgaggggcttgtgaacagtcagctt
ataaggccccggttgtatgagttttccagcgacgtaaataacggaggatctgcaatagga
gttggtagcaacgaggaggtggatgctgggctaattcagaagaagttagacgagtccaag
ctagactccctgattgtgataggaggaagcaaggccctgcacattatcaaggagcttcgg
ggggtcagcattgttctgatacctgcgtcgtcttacaacaatataccagggatcgacata
agcatcggcgccgacacagccctcaatgcggttctgaaagtttctgatgtgtcgaagcta
aactcttttgcatacaagaacaatgtctttgttgtggagatcggaggaggaaactgcggg
tacctgtcgttgatgggcggaatagcagcaggggcatttgaggtttttattccggagagg
aagtacctgataggacatctatcagaggctgcacagaggctccgtatgaagttccgggag
aagacaagaagagggattgtgatcttcagaaacgaaagaacctttcgctcgatttccaca
aagagcttctgtgagatcctgaagaccgacagtggagacctgtttgaaacagactattcc
attcttgggcatatacagcagggacagaacccgtcgccgatagacagaataaacgcagcc
attctgggaatcgaggctatcgacctgtgccggcagaagtgtgggattggggtccttgga
ttttcggaggacaggatcaagtttacaaagattgaagaggttctgaaggagtttgaccat
gagctcgacagagaaaagaatccgtactggctcaagtactccggcatttgtagatcggtt
gaataa

DBGET integrated database retrieval system