KEGG   Encephalitozoon cuniculi: ECU03_0680Help
Entry
ECU03_0680        CDS       T00105                                 

Definition
(RefSeq) 6-PHOSPHOFRUCTOKINASE (PHOSPHOFRUCTO-1-KINASE ISOENZYME A)
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ecu  Encephalitozoon cuniculi
Pathway
ecu00010  Glycolysis / Gluconeogenesis
ecu00030  Pentose phosphate pathway
ecu00051  Fructose and mannose metabolism
ecu00052  Galactose metabolism
ecu00680  Methane metabolism
ecu01100  Metabolic pathways
ecu01110  Biosynthesis of secondary metabolites
ecu01130  Biosynthesis of antibiotics
ecu01200  Carbon metabolism
ecu01230  Biosynthesis of amino acids
ecu03018  RNA degradation
Module
ecu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ecu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECU03_0680
   00030 Pentose phosphate pathway
    ECU03_0680
   00051 Fructose and mannose metabolism
    ECU03_0680
   00052 Galactose metabolism
    ECU03_0680
  Energy metabolism
   00680 Methane metabolism
    ECU03_0680
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    ECU03_0680
Enzymes [BR:ecu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     ECU03_0680
Protein phosphatases and associated proteins [BR:ecu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     ECU03_0680
Messenger RNA biogenesis [BR:ecu03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     ECU03_0680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK Lactamase_B_4
Motif
Other DBs
NCBI-GeneID: 858741
NCBI-ProteinID: NP_597579
UniProt: Q8SSA3
Position
III:complement(86105..88870)
Genome map
AA seq 921 aa AA seqDB search
MIGYRGDKCNLWRKDMQAVIEELLLSGDGISQKHGEVYELLGLDVIYDRGTLKIYSTRRA
KIVSISSGIHVHVSYKVLSHLITRGLVNEDGHGTSLEIVDMMGNKIVATFVGHEKMNRIA
IVTSGGDAPGMNSAIKSIIRTGIKWGASVYGVYNGYDGLINNSIRRLSWDTETYCSSQGG
TVLLSARSLKFREKDGRKLAVLNMVRKRINCMVILGGDGSMEGAAILRDEFKGHLRELIR
EGKISARDLQKMRISRIGLEKGSEEKEQPITDGSGVSYSDFYGKPECYKENPVVHDLNSS
DDVSEDLQADVCLGENTGPDDVEKYVYGLKIVGIPSTIDNDIWGAPVSLGEDTAIHRVVE
AIDHLMSTMKSHSRTFVIEVMGRRCGWIALMSSLASAADYALLPEAPAEWRVEMIETLRI
AKKCGKSGIFVIVAEGAVEKDGTPISASQVVEEIDRAGMEVRLLKLGHIQRGGPTSAQDR
IYGTLLGIRAVEILLGPMRDPVMISIFRDEVSEVELKKVIEKNRAIKSLQERRMFDEILR
NRSNFFRLAYSYFRKSLVGVESAGGCVCNSKKGHEVEHRRGQDPCPDTFSGKVRIGIMQF
GQRSSGMNAALNAAVQYSLMVGAEPFYIPNGFEGLVNSQLIRPRLYEFSSDVNNGGSAIG
VGSNEEVDAGLIQKKLDESKLDSLIVIGGSKALHIIKELRGVSIVLIPASSYNNIPGIDI
SIGADTALNAVLKVSDVSKLNSFAYKNNVFVVEIGGGNCGYLSLMGGIAAGAFEVFIPER
KYLIGHLSEAAQRLRMKFREKTRRGIVIFRNERTFRSISTKSFCEILKTDSGDLFETDYS
ILGHIQQGQNPSPIDRINAAILGIEAIDLCRQKCGIGVLGFSEDRIKFTKIEEVLKEFDH
ELDREKNPYWLKYSGICRSVE
NT seq 2766 nt NT seq  +upstreamnt  +downstreamnt
atgattggttacagaggagataaatgtaatctctggaggaaggatatgcaggctgttatt
gaggagctgctgctgtctggagatgggatatcgcagaagcacggagaggtgtatgagctc
cttgggctggacgtgatatacgacagggggacgctgaagatttacagcactaggagggcc
aagatagtgtccataagctctggaatccatgtgcatgtttcgtacaaggtactgagccac
ctgataacccgggggcttgtcaacgaggacggacacggaacgtctctggagatagtggac
atgatggggaacaagattgtggccacgtttgtggggcacgagaagatgaacaggattgcg
attgtaacgagcgggggagatgctccagggatgaactctgcaatcaagagcataatcagg
accggaataaagtggggagcatcggtgtatggagtatacaatggatatgatgggcttatc
aacaacagcatacgcagactcagctgggacaccgagacctactgcagcagccaagggggg
actgttctcctgtctgcaaggtccctgaagttccgggagaaggatgggaggaagctggcc
gtgctgaacatggtccgaaagaggatcaactgtatggtaatcctggggggtgacgggtct
atggagggtgctgcaatccttagagatgaatttaagggtcatctgagggagcttatacgg
gaaggaaagatttcggcaagggacctccagaagatgaggatcagtaggatagggctagaa
aagggatccgaggaaaaggagcagccaatcacagacggaagtggcgtcagctactctgac
ttctatgggaagccggagtgctacaaggaaaatccagtggtgcatgaccttaactcgtcc
gacgacgtttctgaggatctccaagcagacgtctgtctgggtgagaacacaggtccagat
gatgtcgagaagtatgtctatggcctgaagattgtggggattccatcgaccatagacaac
gacatctggggggctcccgtttctttaggagaggacactgcaatccacagggttgtcgag
gcaatagaccacttgatgtccaccatgaagtcgcattcgcgcacgtttgtcattgaggtc
atgggccggagatgcggatggatagctcttatgtcttccctggcaagtgcagcagactat
gccttgcttcctgaggcgcctgccgagtggagagtggagatgattgaaacgcttagaatt
gcaaagaagtgtgggaagtctgggatatttgtcatcgttgcagaaggggctgttgaaaag
gatggaacacccatatccgcgtcccaggttgtggaggagattgacagggcggggatggaa
gtcaggcttcttaagctgggccatatccagaggggagggccgacctctgcgcaggatagg
atatacggcacccttcttggaatcagggctgtcgagatattgctaggccccatgagagat
cctgtgatgatcagcatcttcagagacgaggtctcggaggttgagctgaagaaggtgata
gagaagaacagggccatcaagagccttcaggagaggaggatgtttgacgagatactgaga
aacagaagtaacttcttcaggttagcttactcgtattttagaaaatcgctggtaggagtg
gaaagtgcaggaggctgtgtctgcaattccaagaaggggcatgaggtcgagcataggcgt
ggccaggatccttgtccagacaccttcagtgggaaggtccgcataggaataatgcagttt
gggcagcgatccagtggtatgaatgcggcactgaatgcagcagtccaatactctctaatg
gtaggggctgagcccttctacatcccaaatggatttgaggggcttgtgaacagtcagctt
ataaggccccggttgtatgagttttccagcgacgtaaataacggaggatctgcaatagga
gttggtagcaacgaggaggtggatgctgggctaattcagaagaagttagacgagtccaag
ctagactccctgattgtgataggaggaagcaaggccctgcacattatcaaggagcttcgg
ggggtcagcattgttctgatacctgcgtcgtcttacaacaatataccagggatcgacata
agcatcggcgccgacacagccctcaatgcggttctgaaagtttctgatgtgtcgaagcta
aactcttttgcatacaagaacaatgtctttgttgtggagatcggaggaggaaactgcggg
tacctgtcgttgatgggcggaatagcagcaggggcatttgaggtttttattccggagagg
aagtacctgataggacatctatcagaggctgcacagaggctccgtatgaagttccgggag
aagacaagaagagggattgtgatcttcagaaacgaaagaacctttcgctcgatttccaca
aagagcttctgtgagatcctgaagaccgacagtggagacctgtttgaaacagactattcc
attcttgggcatatacagcagggacagaacccgtcgccgatagacagaataaacgcagcc
attctgggaatcgaggctatcgacctgtgccggcagaagtgtgggattggggtccttgga
ttttcggaggacaggatcaagtttacaaagattgaagaggttctgaaggagtttgaccat
gagctcgacagagaaaagaatccgtactggctcaagtactccggcatttgtagatcggtt
gaataa

DBGET integrated database retrieval system