KEGG   Encephalitozoon cuniculi: ECU03_1370Help
Entry
ECU03_1370        CDS       T00105                                 

Definition
HISTONE DEACETYLASE 1
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
ecu  Encephalitozoon cuniculi
Brite
Enzymes [BR:ecu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     ECU03_1370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
III:complement(161146..162396)
Genome map
AA seq 416 aa AA seqDB search
MNNKRVVYFYDPEIGCFSYAMGHPMKPLRVKMTHTLLVGYELYKYMDVLRPFQASYENLT
NFHAVDYINFLSSVSSENMEEMIKDLHKFNIRDDCPVFPGLYDYCRLTSGGSIYAAQKIN
SGKYDVAINWAGGLHHAKRGEASGFCYVNDIVLGILELLKYNKRILYIDIDIHHGDGVEE
AFYTTDRVMTVSFHKYGDYFPGTGMVTDTGLAKGKGYSVNVPLKDGIDDESYFSIFKPIV
SKVIETYQPNAIVLQSGADSLSGDKLGCFNLSHLGHSRCIKFVQSFNIPLILLGGGGYTI
GNVSKAWAYGTSVVLDVDIPREIPYNEYFDYYAPTYRIDVPTSNMANQNTREGLEDIIAK
VYENLRSLSHAPSVQMVSIPPSFISDESDEDEVSKKKAEAEDSDDYKAFSDSKDED
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgaacaataagagagtggtttacttctatgaccccgaaataggatgcttcagctacgca
atgggacatccaatgaagcctctgagagtgaaaatgacccatactcttcttgttgggtat
gagctttacaaatacatggatgttctcaggccctttcaggcatcgtacgagaacctgacg
aacttccacgcggtagactacataaacttcctttcaagcgtctccagcgaaaacatggag
gagatgattaaggacctccacaagttcaacatcagagacgactgccctgtgtttccgggg
ctctacgactattgcagactcacgagcggagggagtatttatgcagcccagaaaataaac
tccgggaagtatgatgttgcaatcaactgggctggagggctgcaccatgcgaagagagga
gaagcctctggattttgctatgtaaacgacatagttctagggattctcgagctcctgaag
tacaacaaaagaattctgtacatagatatagacattcatcacggagacggggttgaggag
gcattctataccaccgacagggtcatgacagtctccttccacaagtatggagactatttc
ccagggacagggatggtcaccgacaccggcctggcaaagggaaagggctattcggtcaac
gttccactgaaggacgggattgacgacgaaagctacttcagtatattcaagcccattgtc
agcaaggtcattgagacgtaccagccaaatgcaattgtactgcagtctggggcagactcc
ctttctggagacaagctagggtgcttcaatctgtcgcacctggggcattcaaggtgtatt
aaatttgtgcagagcttcaacatcccactcatccttctgggaggaggtgggtacaccatt
ggaaatgtctcgaaggcatgggcatacgggacaagcgtggttctggatgtggatatcccc
agggaaatcccctacaacgagtattttgattactatgcaccgacatacaggatagatgtt
cctacatcaaacatggcaaaccagaacacaagagaaggcctagaagacattatagcgaag
gtctatgagaatctgaggagcctttctcatgcaccatcggtacaaatggtctccattcct
ccgtccttcatcagcgacgaaagcgacgaggacgaggtttccaagaagaaggctgaagca
gaagactcagacgattacaaagcattctctgattcaaaggacgaggactag

DBGET integrated database retrieval system