KEGG   Encephalitozoon cuniculi: ECU05_0070Help
Entry
ECU05_0070        CDS       T00105                                 

Definition
similarity to HYPOTHETICAL TRANSMEMBRANE PROTEIN YMF9_YEAST
Orthology
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
ecu  Encephalitozoon cuniculi
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:ecu00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    ECU05_0070
Enzymes [BR:ecu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     ECU05_0070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
V:11903..14620
Genome map
AA seq 905 aa AA seqDB search
MVSLSLLIAIIVVTGLLAGFRHYGSSRCRTVPFKIKSRSIEKTASTRLLGMSLEDAMKRY
PLFNFYPGQSIREILSSWERVTYGNGETIAAPGFILQGLVEIWYREHLVCVKEKGSFLNG
SMELLGYSTRGTKKARGSVEVLLIDASLVRDNIWYILFSMLRKSCIEIACRYFELESKLV
EKETMKIKDDGQGHLDLFLSFLNEKLLLNLDDGKEILRRDIEARLIGRGETIKDSEESMD
YIMYVVSGEILVLAGESAFVFGKGSVFGYFSLFFDLYSSIKIQAREDSSVLLCSSSVLLK
FGLDEKKFDHSMLLDIDESLHIIDESAEWMRLLPGDMIAQKGDASKEIFYIGAGSVKSAS
RESSSGTVIGGKECIFGESWNESSIATRITDVVRIPSLLVDYFLERDKSFFKKYTKRLFE
SGNKANGKIVSIIPVGQYKDIESFSRKLKSAIGASSLLLSRRDVVEILARRAFDTTEEVR
FMDYLTKMSRRYEIILIYVENEYSRLLRYLLNFSDVLLAVGTTFADIPEYNVYCRIEFVK
IYEERRASDERSVKKSKKINHGPRYLESRKESFGQYDRVHHVLFPSKTMLFCSKDFQRLA
RSLLGKRIGLVLGGGGARGLAHIGVIQALEEEGIPIDCVGGTSMGAFIGALYAKECNNYH
VFKQAKRFSRKMSNIWILLLDLTYPICSMFSGHAFNRSLHSIFGDGLIQDLWLEYFCITT
NIVSYEEEVHRNGMVWRYVRASMGLCGYLPPICDNKKLLVDGGYLNNVPADVMMGMQVEK
IITVDVGTVLENDHFDYGDTLSGFTILFNKFFGNKKFVTMEEIQYRLAYISTERKMKELE
ANGNIIMLRPDLGKYRTMDFKKFDEIVACGYQSTKNAIAKWKQEGTYDVLFFSLKKQTPK
RRYSV
NT seq 2718 nt NT seq  +upstreamnt  +downstreamnt
atggtatcactatctcttctaattgcaataatagttgtaactggattgctggctggattt
aggcactatggatcctcaaggtgtaggacagttccctttaagatcaagtcgagaagcatc
gagaaaacagcatccacaaggctgcttggcatgtctctggaagatgcaatgaagagatat
ccattgtttaatttttatccagggcagtcaattagagagatcctgagcagctgggagaga
gtgacatacggaaatggagagacgatagcagcgcctggatttatattacagggcttggtg
gagatatggtacagggagcaccttgtttgtgtaaaagaaaaaggttcttttcttaatgga
tctatggagctgctgggatatagcacaagaggaaccaaaaaagcaaggggctctgtcgag
gttcttctgattgatgcatctctagttagagacaacatctggtacattctgttttccatg
cttagaaagtcatgcattgagatagcctgtagatactttgaattggagagcaagctggtc
gaaaaggaaactatgaagatcaaggatgatggccaaggccatttggacttattcttgtcc
tttttaaacgaaaagcttttgttgaacctggacgatggaaaggagattctcagaagggac
attgaagcgaggctcattggcagaggcgagactatcaaagacagcgaagagtctatggac
tacataatgtatgtggtttctggagagattttagtactggccggcgaaagtgcctttgtt
tttggaaaaggatctgtctttggatatttttctctattcttcgacttatattcgtcgata
aagatccaggcaagagaggattcttcagtccttctgtgcagctcatcagttttgcttaag
ttcgggctagatgaaaagaaattcgaccattccatgctgttagacatcgatgagtctctc
catattatagatgaatctgctgagtggatgaggcttttgcctggagatatgattgctcag
aagggagacgcttcaaaggagatcttctacattggagcgggaagtgtgaaatctgcatct
agggagtcttcatctggaacggtgatcggaggcaaggagtgcatctttggagagagttgg
aacgagtcgtccatagcaactagaataacagatgttgttcggattccgtctcttttggtt
gactactttcttgaaagggataagagcttttttaagaaatacaccaaaagactgtttgag
agtggaaacaaggcgaatggaaagatagtcagcataatccctgttgggcaatacaaggac
atcgaatctttttcaaggaagctcaagtctgcaattggcgcttcttctttgctcctcagc
cgtagagatgttgttgaaatccttgcaagaagagcgtttgataccactgaagaggttaga
tttatggactatcttacaaagatgtcgaggcgttacgaaattattcttatctatgtggaa
aatgagtattccaggttgcttaggtatttgctaaacttttcggacgttctgctggctgtt
ggaacgacctttgcagacatccccgaatataacgtctactgcaggatcgaatttgttaag
atctacgaggaaagaagagcttctgacgaaagaagtgtcaagaaaagcaaaaagatcaac
cacggaccccggtacctagaaagcaggaaagaaagctttggacaatatgatagagttcat
catgttttgtttccttcgaaaaccatgttgttctgttccaaagactttcagagacttgca
aggtcattgctgggaaagagaataggccttgttttgggtggaggaggagcaaggggccta
gctcacattggagttatccaggctcttgaagaagaaggaattcctatagattgtgttgga
ggcacaagcatgggggcattcatcggcgccctatatgcgaaagaatgtaacaactaccac
gtatttaaacaagccaaaagattttccagaaagatgtcgaatatatggattcttttactg
gatctgacctaccccatttgctccatgttttctggccatgcatttaacaggtcactccac
tctatctttggagatgggctaattcaggatctatggctggagtacttttgtatcaccacc
aacatagtcagctatgaagaagaggtgcatagaaatggaatggtgtggagatatgttcga
gccagcatggggctctgtggatatctgcctccaatatgtgataacaagaagctactagtt
gatggagggtatctaaacaatgttcctgcagatgtcatgatgggcatgcaggttgagaag
atcatcactgtggatgttggaacggtcttggagaacgaccactttgactatggggatact
ctcagcggatttaccattctgttcaacaagttttttggaaacaaaaagtttgtgacgatg
gaggagattcaatacaggctggcctacatttctactgagcgaaagatgaaagagcttgaa
gcaaatggaaatataattatgctgagacctgacctcgggaaatacaggactatggacttt
aagaagttcgatgaaattgttgcatgtggataccagtctacgaagaatgcaatcgcaaaa
tggaaacaggaggggacttacgatgttcttttctttagtctgaagaagcaaacgccaaaa
agaagatattctgtgtga

DBGET integrated database retrieval system