KEGG   Encephalitozoon cuniculi: ECU05_0310Help
Entry
ECU05_0310        CDS       T00105                                 

Definition
(RefSeq) ACETYLCOENZYME A SYNTHETASE
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ecu  Encephalitozoon cuniculi
Pathway
ecu00010  Glycolysis / Gluconeogenesis
ecu00620  Pyruvate metabolism
ecu00640  Propanoate metabolism
ecu00680  Methane metabolism
ecu01100  Metabolic pathways
ecu01110  Biosynthesis of secondary metabolites
ecu01130  Biosynthesis of antibiotics
ecu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ecu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECU05_0310
   00620 Pyruvate metabolism
    ECU05_0310
   00640 Propanoate metabolism
    ECU05_0310
  Energy metabolism
   00680 Methane metabolism
    ECU05_0310
Enzymes [BR:ecu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     ECU05_0310
Lipid biosynthesis proteins [BR:ecu01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   ECU05_0310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding ACAS_N AMP-binding_C
Motif
Other DBs
NCBI-GeneID: 859035
NCBI-ProteinID: NP_597371
UniProt: Q8SRZ9
Position
V:43190..45088
Genome map
AA seq 632 aa AA seqDB search
MDRSEYEGLYKRSIEDKEGFWGEQAKVLLKWDRMFDRVYNNDFENSRWFEGGMLNACYNC
VDRHAACSPDKVAVIYEGNDGESVYYTFKDVLDEVIRICTILKDEGLEKGDTVAMYMAMS
PYAVFSALACARLGLVHNAIFGGFSASSVALRLNDSNAKLLIVQDVVARQDSTMNFLENT
RVALKGKSIPVLVFDTFLDERKILDSLDGIGGRILIWSKVLKRENEFIPCVSVNAEDRLF
YLYTSGSTGKPKGIIHTAGGYLVYAMLTSKICFDLQENDVFACTADIGWITGHTYVIYGP
LLNGITTVVFGGTPFYPSYYRLFKMVEKYRITQLYTAPTVIRMLRKHFSTTPLDHNYDLS
SLRILGSVGEPINKNAHLWFSENFNGCPVIDTYWQTESGGILIAPIPHAVDIKPECACLP
FLGQEVVIADPSSRSDCVVEAKAYELGRVLLKGSWPGITRGILGNPERFRKGYFFYKGFY
FTGDEGYKDSDGHVWIRGRADDVINVSGHRISTAEVEGAACTDPHIAEAAAVAESDDITG
QALCIFVVLKDRKTSHEGVRASLRTTLRSKIGKFVNAKRIYFCEGIPKTATGKIMRRVLK
SILAGDPPGDVSTCTNADIIEGLREIAGSEVN
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atggacagaagcgagtatgagggattgtacaagagatctattgaggataaagagggtttt
tggggagagcaagcaaaggtgcttttgaagtgggacaggatgtttgacagggtttacaac
aatgactttgagaactcaaggtggttcgaaggaggtatgttgaatgcatgctataattgc
gttgatagacatgcggcctgcagcccggacaaagtcgcggttatttatgagggaaacgat
ggggagtcggtctactacacattcaaagacgtccttgatgaagttataaggatctgtacc
atacttaaggacgaaggtcttgagaagggagatacggttgctatgtatatggcaatgtcc
ccgtatgcagtgttttctgcacttgcatgtgctaggcttggtcttgtgcataatgcaatc
ttcggaggatttagtgcaagcagcgtggctctacggcttaacgactcgaatgccaagctt
ttaatagtccaggacgtcgttgcaaggcaagactccaccatgaacttccttgagaacaca
agggtagcgctcaagggaaaatcaattcctgttctagtcttcgacacatttctggacgag
agaaagatcttagattcactggatgggattggaggaaggattctgatatggtcaaaggtt
ttgaagagggagaatgaattcattccctgtgtctcggtcaatgcagaggacagacttttc
tatctgtacacaagtggaagtacaggaaagccaaaaggaattatccacacggccggtggg
tatctggtgtatgcgatgcttacttccaaaatatgctttgatcttcaagaaaacgatgtt
tttgcctgtacggcagacataggatggatcacagggcatacatatgtcatttacgggccg
ctgttgaatggaatcacgaccgttgtatttggaggaacgcccttctatccttcgtattac
aggctcttcaagatggtcgaaaagtatagaataactcagttgtacactgcgcctacagtt
ataaggatgctgaggaagcatttttccacaacaccccttgatcacaactatgacctgtct
tccctgagaattctcggatctgttggagagccgataaataagaatgcccatctgtggttt
agtgagaacttcaacggctgtcctgttattgatacatattggcaaactgaatctggtggg
attctgattgcgcctattccgcacgccgtagacataaagcctgagtgtgcctgtcttcca
tttttaggccaagaggttgttattgcggatccgagctctagaagcgactgtgttgtcgaa
gcgaaggcctatgagttagggcgtgttcttctcaagggttcctggcctgggataaccaga
gggattctaggaaacccggagagattcagaaagggatattttttctacaagggattctac
ttcacgggcgacgaaggatataaagattctgatggacatgtgtggatcagaggaagagct
gacgacgtgataaatgtctctggacacaggattagcacggcagaggtcgaaggcgcggca
tgtacggatccgcatatagctgaggcagcagctgttgcagaaagcgacgatattactggg
caggccctttgcatttttgtggtcttgaaagacaggaaaacatctcatgaaggagtaaga
gcgtctctgagaacaactctgagaagcaagatcggaaagtttgttaatgcaaaaagaatc
tacttctgtgaaggtattcccaagactgcaactggaaagatcatgagaagagtcctgaaa
agtatcctggccggagatccgcctggagatgtatcgacttgtaccaatgcagacattatt
gagggcctgagagaaattgctggatcggaagtaaattaa

DBGET integrated database retrieval system