KEGG   Encephalitozoon cuniculi: ECU06_0360Help
Entry
ECU06_0360        CDS       T00105                                 

Definition
(RefSeq) REPLICATION FACTOR A PROTEIN 2 (32KDA SUBUNIT)
  KO
K10739  
replication factor A2
Organism
ecu  Encephalitozoon cuniculi
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ecu00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    ECU06_0360
   03420 Nucleotide excision repair
    ECU06_0360
   03430 Mismatch repair
    ECU06_0360
   03440 Homologous recombination
    ECU06_0360
DNA replication proteins [BR:ecu03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    ECU06_0360
DNA repair and recombination proteins [BR:ecu03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     ECU06_0360
   MMR (mismatch exicision repair)
     ECU06_0360
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     ECU06_0360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VI:complement(48229..49053)
Genome map
AA seq 274 aa AA seqDB search
MWTVPLASLTISGMPEAIWLATLYLLKRSDSLFFITRGQIFGTGNPTPMDRSEGGYIQSS
PKRELLGVKTLRALTIKQIGSCDFDETSSTHLVDSAEVTNVQIIGWVVSSKTSATGSMFV
LEDGTGSVDCTFWPGNSYEEEQCKVLEEQNLLKVNGSLRTFNGKRSVSASHLSAVEDSNF
VTYHFLSCIYQHLFYTRQLQREEVKNDGAKLDRIQEDILECYRRNQDENGLHINVVIKML
SSKYSESEVRENIDVLLRDCHLYSVDGLEYKTTI
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgtggacagtgccgttggcatctctgaccatcagcgggatgccagaggccatctggttg
gcgactctgtatctcttgaagagatcagactcgttattcttcatcacaagagggcaaatt
tttggtaccggaaatcctacacccatggacaggagcgaaggcggatacatccagagctct
ccgaaaagagagctccttggagtaaagacactaagggcgcttacgatcaagcaaatcggc
agctgcgacttcgatgagacatcctcaacgcacctggttgactctgcagaagtcacaaat
gtacagatcattggctgggttgtctcgtcaaaaacatcagcgacaggatcgatgtttgtt
ttggaggacggaacaggcagcgtagactgtacattctggccagggaattcctacgaagag
gagcagtgcaaggtgcttgaggagcaaaaccttctcaaggtcaacggatcgctcagaaca
ttcaacggcaaaaggagcgtgtctgcatcacatctgtccgcggtggaagactcaaacttt
gttacctaccacttcctaagttgcatctaccagcacctgttctatacaagacagctccaa
agggaagaggtcaagaacgatggtgcaaagctcgacaggatccaggaggacatactggag
tgttacaggaggaaccaagacgaaaacgggctccacattaatgtggtcatcaagatgctt
tcatctaagtattcagagagcgaagtcagggagaacatcgacgtcttgctgcgagactgc
catctgtacagcgtggatgggctggaatacaagacaacgatttag

DBGET integrated database retrieval system