KEGG   Encephalitozoon cuniculi: ECU06_0360Help
Entry
ECU06_0360        CDS       T00105                                 

Definition
REPLICATION FACTOR A PROTEIN 2 (32KDA SUBUNIT)
Orthology
K10739  
replication factor A2
Organism
ecu  Encephalitozoon cuniculi
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ecu00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    ECU06_0360
   03420 Nucleotide excision repair
    ECU06_0360
   03430 Mismatch repair
    ECU06_0360
   03440 Homologous recombination
    ECU06_0360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VI:complement(48229..49053)
Genome map
AA seq 274 aa AA seqDB search
MWTVPLASLTISGMPEAIWLATLYLLKRSDSLFFITRGQIFGTGNPTPMDRSEGGYIQSS
PKRELLGVKTLRALTIKQIGSCDFDETSSTHLVDSAEVTNVQIIGWVVSSKTSATGSMFV
LEDGTGSVDCTFWPGNSYEEEQCKVLEEQNLLKVNGSLRTFNGKRSVSASHLSAVEDSNF
VTYHFLSCIYQHLFYTRQLQREEVKNDGAKLDRIQEDILECYRRNQDENGLHINVVIKML
SSKYSESEVRENIDVLLRDCHLYSVDGLEYKTTI
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgtggacagtgccgttggcatctctgaccatcagcgggatgccagaggccatctggttg
gcgactctgtatctcttgaagagatcagactcgttattcttcatcacaagagggcaaatt
tttggtaccggaaatcctacacccatggacaggagcgaaggcggatacatccagagctct
ccgaaaagagagctccttggagtaaagacactaagggcgcttacgatcaagcaaatcggc
agctgcgacttcgatgagacatcctcaacgcacctggttgactctgcagaagtcacaaat
gtacagatcattggctgggttgtctcgtcaaaaacatcagcgacaggatcgatgtttgtt
ttggaggacggaacaggcagcgtagactgtacattctggccagggaattcctacgaagag
gagcagtgcaaggtgcttgaggagcaaaaccttctcaaggtcaacggatcgctcagaaca
ttcaacggcaaaaggagcgtgtctgcatcacatctgtccgcggtggaagactcaaacttt
gttacctaccacttcctaagttgcatctaccagcacctgttctatacaagacagctccaa
agggaagaggtcaagaacgatggtgcaaagctcgacaggatccaggaggacatactggag
tgttacaggaggaaccaagacgaaaacgggctccacattaatgtggtcatcaagatgctt
tcatctaagtattcagagagcgaagtcagggagaacatcgacgtcttgctgcgagactgc
catctgtacagcgtggatgggctggaatacaagacaacgatttag

DBGET integrated database retrieval system