KEGG   Encephalitozoon cuniculi: ECU06_0910Help
Entry
ECU06_0910        CDS       T00105                                 

Definition
UBIQUITIN CARBOXYL-TERMINAL HYDROLASE
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.1.2.15]
Organism
ecu  Encephalitozoon cuniculi
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VI:121060..123240
Genome map
AA seq 726 aa AA seqDB search
MMAEESLDQKPASSSGQCEYAVSFAFAKSQGMFRRASCIDGSSNPKVPGPRVDFVPESVW
KSMRDGLFVSPACGADVQLQPRSTGKAVLITFMIDELIPSASAPGSSKSVVVKVGWIFSI
LQSLINLGDLVPHEAPSHGGGMRRSRRVVNAIVDPTDRLFDIVPEIMGLRLGLDEFMRRY
RVLASDGRVLHPLARLDEFENRSVLKISKITRMPDGRVLSVDDHMRSIVRGLRNQGNTCF
MNSGLQCLMNCWKLSEYFISREYEESLNRHKAIHASLASAYYDLISQVYDGNLHAITPVG
IRKSLGSIYEEYKGNDEQDSVEFITKMLDTLHEALSTQSSHPKKKEKEKWWEHNRSIITD
LFFFCLKSTLTCRGCGSTKVSIEPAVCLSLPIPRSMQHKDNIVVFYESGRRQPVKIYADA
STSIRGLKKLLDAEYGVLGKVMCIWYDGNRNMLEPADDVVLQDIPQTLFCYEYSEDIEYC
WVHLKTKRLFMDKSFKFNILIKASGYDGLLVLLEMKKTLACLVSEEVRCLLEESSISSYF
KLENAGKTPREKQMNFPVAVVISRAHEGKRLLSLFHDPLGTIREIGAPKPTLQHCVNRFL
EKEDLHPSERLHCEGCNGKMMFSKKMDLEDLPMYLIIQLKRFQYVNSSPMKISTLIEYPL
DKFLLNGVEYMVIGVCNHDSDAVTSSGHYVSYLRKNGWYLCNDQKIERVDEVDKEHTYVL
FLERCS
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atgatggctgaggagtccctggatcagaagccagcctcaagttcaggccaatgcgagtat
gctgtatcctttgccttcgctaagagccaggggatgttcaggagggcatcgtgtatagac
ggcagttcaaatcctaaggtgccagggcccagagttgacttcgtcccagaaagtgtttgg
aaatccatgagagatggcctctttgtgtctccggcatgcggtgccgatgtgcagcttcag
cccaggagtacaggaaaggctgtccttattacctttatgattgacgagcttattcccagc
gccagtgctcctggatccagtaagagcgtggttgtcaaggttggatggattttctccata
ctccagtcgctcatcaacctcggagatcttgtgccccatgaggcgcctagccacggggga
gggatgaggaggtccagaagagttgtgaacgccattgtcgaccccacagataggttgttc
gatatagtcccggagatcatgggcctccgccttggcctagacgagtttatgaggagatac
agagttctagcatccgacgggagagtgctccatcctttggcgaggcttgacgagtttgag
aacaggagtgtgctaaagatttcaaagatcacaaggatgcctgacggaagggttctatct
gttgacgatcacatgaggagcattgttcgcggactcaggaaccaggggaatacctgcttc
atgaacagcgggctccagtgcctgatgaactgctggaagctctcagagtacttcataagc
agggagtatgaagagtccctgaacaggcacaaagctatccatgcatccttggcaagtgca
tactacgaccttatttcccaggtatatgatggaaacctccatgccatcacacccgtggga
atcagaaaaagcctggggtcgatatacgaggagtacaagggaaacgacgagcaggactcc
gtcgagtttatcaccaagatgctggacacactacacgaggccctttccacccaatcctcg
catcccaagaagaaggaaaaggaaaagtggtgggagcacaacagatcaattattacagac
ctgtttttcttctgcctgaagtccacactgacatgccggggatgcggcagtaccaaggtg
tccatcgagcctgcagtgtgcctctctctaccaattccccgttccatgcagcacaaagat
aacattgtggtgttctatgaatcaggcaggagacagcctgtgaagatatatgccgatgca
tccaccagcatcagaggcctcaagaagctactggatgccgaatatggggtactaggaaag
gtcatgtgcatatggtatgacggcaacaggaatatgcttgagcctgcagatgacgttgtc
ttacaggacattccgcaaacactgttctgctatgagtactccgaagacattgagtactgc
tgggtccacctgaagaccaagaggctgtttatggacaagtcattcaagttcaacattctg
atcaaggcctctggctacgacggactactggtgctcctggagatgaagaagacccttgct
tgccttgtttcggaggaggtccgatgcctcttggaggagagcagcatatcctcctacttc
aaactagagaacgcaggcaaaaccccgagggaaaagcagatgaactttccagtggcggta
gtgataagcagagcccatgaaggcaaaaggctgctcagcctgttccacgacccgttgggc
acgattagagagataggcgcgcctaagccaaccctccagcactgcgtaaatagatttcta
gaaaaagaggatctccatccatcagagcgcctgcactgcgagggatgcaatggaaagatg
atgtttagcaagaaaatggatctggaggacctcccgatgtatctgataatccagctgaaa
agattccagtatgtaaacagctcaccgatgaagatctcgacgctgattgagtatcccctt
gacaagtttctcctcaatggagttgagtatatggtcataggagtgtgcaaccatgactcg
gacgcagtcacgtcgagcgggcattatgtaagctatctgcggaagaacggatggtatctc
tgcaacgaccagaagatcgagagagtcgatgaagtcgacaaggagcacacgtatgtcctt
ttccttgaaagatgttcctag

DBGET integrated database retrieval system