KEGG   Encephalitozoon cuniculi: ECU06_1550Help
Entry
ECU06_1550        CDS       T00105                                 

Definition
mRNA ASSOCIATED PROTEIN OF THE RAE1 FAMILY
Orthology
K14298  
mRNA export factor
Organism
ecu  Encephalitozoon cuniculi
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:ecu00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    ECU06_1550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VI:complement(197425..198381)
Genome map
AA seq 318 aa AA seqDB search
MAQYNTKISDIPNPPSDTVSEVAFSQMHGLMAASSWDGTVRTYDLENLYSPNTSVVNLNK
PLLTCCFSKETPSLAFAGAADGSLQIVDLQTSQVSSFQAHNAGVRSVRCFSNMLVTGSWD
KTVKFWDTRSSKLVFSLDLPGKVYAMDLEKEMLAMSLSGNEVATYNLNDINQKKTHASKL
NWMIRSIACAQDNETFALGGIEGKAEIFNINSPVKKMIFRCHRVDNKVYAVNSVSFLPTN
HNILVTAGGDGTIVFFDAQARMKIFTQTESQPVTCGRFNTSGSYYVYATGNDWSAGYVTT
YRPTQLRAIQVSTTGVKI
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atggctcagtacaacaccaagatttccgacatccccaatcctccatccgacacggtttcg
gaggtggcattcagccagatgcacggcctgatggctgcatccagctgggatggcactgtc
cgaacatatgacctggaaaatctatacagtccaaataccagtgttgtgaatctgaacaag
cctcttcttacttgttgcttcagcaaggagacaccttcgctagcttttgcaggcgctgca
gacggaagcctccaaatagtggatctgcaaaccagccaggtgtcgtccttccaagcacat
aatgcaggagtcaggtctgtaaggtgcttttcgaacatgctggtcaccggatcgtgggat
aaaacggtcaagttttgggatacccggtcctcaaagcttgtgttttctctggatctccca
gggaaagtctatgccatggaccttgagaaggaaatgcttgccatgtctctttccggaaat
gaggtagcaacatacaatctgaacgacataaaccaaaagaaaacgcatgcatccaagctg
aactggatgattaggtctattgcctgtgcccaggacaatgagacctttgcgctggggggg
atagaaggaaaggcagagatattcaacatcaactctcctgtgaagaagatgatctttaga
tgccacagggttgacaacaaggtctatgccgtcaattctgtatcattcctacctactaat
cacaacatattggttactgcaggcggcgatggcaccatcgtattttttgatgcacaggca
agaatgaaaatatttacccagacagagagccagcctgtaacatgcggtagattcaatacc
agcggaagctattatgtctatgccaccgggaatgattggtctgcaggatacgtgacaaca
tacaggcctacgcaacttagagctatccaggttagcaccacgggcgtaaaaatatga

DBGET integrated database retrieval system