KEGG   Encephalitozoon cuniculi: ECU07_0520Help
Entry
ECU07_0520        CDS       T00105                                 

Definition
(RefSeq) cAMP-DEPENDENT SER/THR PROTEIN KINASE (ALPHA SUBUNIT)
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
ecu  Encephalitozoon cuniculi
Pathway
ecu04113  Meiosis - yeast
ecu04138  Autophagy - yeast
Brite
KEGG Orthology (KO) [BR:ecu00001]
 Cellular Processes
  Transport and catabolism
   04138 Autophagy - yeast
    ECU07_0520
  Cell growth and death
   04113 Meiosis - yeast
    ECU07_0520
Enzymes [BR:ecu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     ECU07_0520
Protein kinases [BR:ecu01001]
 Serine/threonine kinases: AGC group
  PKA family
   ECU07_0520
Messenger RNA biogenesis [BR:ecu03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     ECU07_0520
Chromosome and associated proteins [BR:ecu03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    ECU07_0520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like APH RIO1 Haspin_kinase Choline_kinase Kdo
Motif
Other DBs
NCBI-GeneID: 859409
NCBI-ProteinID: NP_585980
UniProt: Q8SRK8
Position
VII:69263..70231
Genome map
AA seq 322 aa AA seqDB search
MLKIQDFEFVKVVGVGAFGKVHLVRLKSSPTSVFAMKMLDFGEILRQRLADQLENEISIL
KRIYGCPFVAKLYSTDFHGGKVGLIMEYVGGGELFYWLKKCGRFDEQMARFYAAEIISAL
RFIHGRGILYRDLKPENILITSTGHIKLIDFGFSVYESENIYMISGTPEYMSPEKLRSED
DGRASDYWGLGVMIYEMLCGDPPFYDSSADAIYHKILESNVVFPHYVSPVARCLITGLLD
KNRATRLGTKGICEIMGHPFFKGIDWHEVESRRIEPPFIPNPNTVLSSLASSGELKGTDD
AETVVLKPYKHIKHLYKVSKGL
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgttgaagatccaggacttcgaatttgtaaaagtcgtgggagtgggggcctttggcaag
gtgcatctggtgaggctcaagagcagtcccacgtccgtgtttgcaatgaaaatgctcgac
ttcggagagattctcaggcaaaggctggcggatcagcttgaaaacgagatctccattctg
aagcggatctatgggtgcccgttcgttgcaaagctgtactcgacagacttccacggtgga
aaggtgggactgattatggagtatgtcggaggaggagagttgttttactggctcaaaaag
tgcggaagatttgatgagcagatggcccggttttatgcagcagagatcatttccgccttg
cgattcatacatggaaggggcattctatacagagatctgaagcccgagaacatactgatc
acatccacaggacacataaagctgattgactttgggttttctgtctacgaaagcgaaaac
atatacatgatttcagggactccagaatatatgtctccagaaaagctgaggagcgaggat
gacgggcgtgcaagcgactattggggactgggggttatgatctacgagatgctgtgtgga
gaccctccgttctatgactcaagtgcagatgcgatttaccacaagatactggagtccaat
gttgtgtttccccactatgtaagcccggttgcaaggtgtctaataacagggctgttagac
aagaacagggctaccaggctggggaccaaaggaatatgcgagataatggggcatcctttc
ttcaaggggatagactggcacgaggttgagagcaggaggattgagcccccgttcattccc
aatccaaacactgttcttagttctttggctagcagcggtgaactcaaaggcacggatgat
gcagagacggttgttttaaagccgtacaagcatattaagcatctgtacaaggtctcgaag
ggactgtaa

DBGET integrated database retrieval system