KEGG   Encephalitozoon cuniculi: ECU07_0520Help
Entry
ECU07_0520        CDS       T00105                                 

Definition
cAMP-DEPENDENT SER/THR PROTEIN KINASE (ALPHA SUBUNIT)
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
ecu  Encephalitozoon cuniculi
Pathway
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:ecu00001]
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    ECU07_0520
Enzymes [BR:ecu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     ECU07_0520
Protein kinases [BR:ecu01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   ECU07_0520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VII:69263..70231
Genome map
AA seq 322 aa AA seqDB search
MLKIQDFEFVKVVGVGAFGKVHLVRLKSSPTSVFAMKMLDFGEILRQRLADQLENEISIL
KRIYGCPFVAKLYSTDFHGGKVGLIMEYVGGGELFYWLKKCGRFDEQMARFYAAEIISAL
RFIHGRGILYRDLKPENILITSTGHIKLIDFGFSVYESENIYMISGTPEYMSPEKLRSED
DGRASDYWGLGVMIYEMLCGDPPFYDSSADAIYHKILESNVVFPHYVSPVARCLITGLLD
KNRATRLGTKGICEIMGHPFFKGIDWHEVESRRIEPPFIPNPNTVLSSLASSGELKGTDD
AETVVLKPYKHIKHLYKVSKGL
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgttgaagatccaggacttcgaatttgtaaaagtcgtgggagtgggggcctttggcaag
gtgcatctggtgaggctcaagagcagtcccacgtccgtgtttgcaatgaaaatgctcgac
ttcggagagattctcaggcaaaggctggcggatcagcttgaaaacgagatctccattctg
aagcggatctatgggtgcccgttcgttgcaaagctgtactcgacagacttccacggtgga
aaggtgggactgattatggagtatgtcggaggaggagagttgttttactggctcaaaaag
tgcggaagatttgatgagcagatggcccggttttatgcagcagagatcatttccgccttg
cgattcatacatggaaggggcattctatacagagatctgaagcccgagaacatactgatc
acatccacaggacacataaagctgattgactttgggttttctgtctacgaaagcgaaaac
atatacatgatttcagggactccagaatatatgtctccagaaaagctgaggagcgaggat
gacgggcgtgcaagcgactattggggactgggggttatgatctacgagatgctgtgtgga
gaccctccgttctatgactcaagtgcagatgcgatttaccacaagatactggagtccaat
gttgtgtttccccactatgtaagcccggttgcaaggtgtctaataacagggctgttagac
aagaacagggctaccaggctggggaccaaaggaatatgcgagataatggggcatcctttc
ttcaaggggatagactggcacgaggttgagagcaggaggattgagcccccgttcattccc
aatccaaacactgttcttagttctttggctagcagcggtgaactcaaaggcacggatgat
gcagagacggttgttttaaagccgtacaagcatattaagcatctgtacaaggtctcgaag
ggactgtaa

DBGET integrated database retrieval system