KEGG   Encephalitozoon cuniculi: ECU08_0080Help
Entry
ECU08_0080        CDS       T00105                                 

Definition
DIHYDROFOLATE REDUCTASE
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
ecu  Encephalitozoon cuniculi
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ecu00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:ecu00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VIII:15715..16332
Genome map
AA seq 205 aa AA seqDB search
MLALVVALASHRGIGNANALPWPRPLAADMAWFRTLSQSIPLISPDRIALAPSASNAVVM
GRRTWDSIPSRFRPLANRINVVLSRGPARSTENTFFIQTFEALDSLPLPPSSMTFVIGGR
DVYSLALESGRPHLIFATEVFESPECDVFFPHIDWASYEKRDITRDVSRLIDRTLASAFY
SPETATFTENGTSFKMFLYTKPETR
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgcttgcattggtcgttgcccttgctagccaccgcggaataggaaatgccaatgccctt
ccatggccacggcccctggctgctgacatggcctggttcaggacactctcccagagcatc
ccgctcatctccccagaccgcatcgcccttgccccgtctgcatccaatgccgttgtcatg
ggcaggaggacgtgggactccatcccctccaggttcaggccccttgccaaccgcatcaac
gtcgtcctgtcgagaggccctgccagaagcacagaaaacaccttcttcatccagaccttc
gaggccctcgactccctgcccctcccgccgtcgtccatgacatttgtgatcggagggcgc
gacgtctacagccttgcactcgagagcggcaggccccaccttatatttgccaccgaggtc
ttcgagtctcccgagtgcgacgtgttcttcccccacatcgactgggcatcctacgaaaag
cgagacatcacccgggacgtctccaggctcatagaccgcacactcgcgagcgccttctac
agccccgagacggccacctttacagagaacgggacctccttcaagatgtttctctacact
aaaccggagacccgctag

DBGET integrated database retrieval system