KEGG   Encephalitozoon cuniculi: ECU08_0080Help
Entry
ECU08_0080        CDS       T00105                                 

Definition
DIHYDROFOLATE REDUCTASE
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
ecu  Encephalitozoon cuniculi
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ECU08_0080
   00670 One carbon pool by folate
    ECU08_0080
Enzymes [BR:ecu01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     ECU08_0080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VIII:15715..16332
Genome map
AA seq 205 aa AA seqDB search
MLALVVALASHRGIGNANALPWPRPLAADMAWFRTLSQSIPLISPDRIALAPSASNAVVM
GRRTWDSIPSRFRPLANRINVVLSRGPARSTENTFFIQTFEALDSLPLPPSSMTFVIGGR
DVYSLALESGRPHLIFATEVFESPECDVFFPHIDWASYEKRDITRDVSRLIDRTLASAFY
SPETATFTENGTSFKMFLYTKPETR
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgcttgcattggtcgttgcccttgctagccaccgcggaataggaaatgccaatgccctt
ccatggccacggcccctggctgctgacatggcctggttcaggacactctcccagagcatc
ccgctcatctccccagaccgcatcgcccttgccccgtctgcatccaatgccgttgtcatg
ggcaggaggacgtgggactccatcccctccaggttcaggccccttgccaaccgcatcaac
gtcgtcctgtcgagaggccctgccagaagcacagaaaacaccttcttcatccagaccttc
gaggccctcgactccctgcccctcccgccgtcgtccatgacatttgtgatcggagggcgc
gacgtctacagccttgcactcgagagcggcaggccccaccttatatttgccaccgaggtc
ttcgagtctcccgagtgcgacgtgttcttcccccacatcgactgggcatcctacgaaaag
cgagacatcacccgggacgtctccaggctcatagaccgcacactcgcgagcgccttctac
agccccgagacggccacctttacagagaacgggacctccttcaagatgtttctctacact
aaaccggagacccgctag

DBGET integrated database retrieval system