KEGG   Encephalitozoon cuniculi: ECU08_0160Help
Entry
ECU08_0160        CDS       T00105                                 

Definition
CALCINEURIN BETA SUBUNIT
Orthology
K17610  
calcineurin B homologous protein 1
Organism
ecu  Encephalitozoon cuniculi
Brite
Protein phosphatases and associated proteins [BR:ecu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     ECU08_0160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VIII:24242..24844
Genome map
AA seq 200 aa AA seqDB search
MGSLSSTMLCEEEIEELKNTTVFDEREIEHLYERFQFLDRESRGYLTYNELNNIPEFQSN
PFSHLIMKSIEKMTDYEKMTFPHFLEFLGIFSERNSKRNRIRYLFDIFDLNGDGRLCRNV
LIRINKMMGQDGRVEEAENLLNIYDEGGKGYLDISDFTRFYESDPLIDKNMIIDFSKNLK
ERRQVGFMQVLWPSTYKDEP
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggggtcgctgagcagcacgatgctgtgcgaagaggaaatagaggagctgaagaacact
accgtctttgatgaaagggaaatcgagcatctgtacgaaaggtttcagtttctggacaga
gagtcccgtggatacctgacatacaatgagctgaacaacattcccgagtttcagtcgaac
cccttcagccacctaataatgaagagcattgagaagatgacggactacgagaaaatgaca
tttccgcactttctcgagtttctggggattttttctgaaagaaatagcaaaagaaacaga
ataaggtatctgtttgacatcttcgacttgaatggagacggaaggctctgcagaaacgtg
ctcatcagaattaacaagatgatgggccaggacggaagggtcgaagaggcagagaacctt
ctgaatatttacgatgagggagggaaaggatatctggacatatctgactttactcggttt
tacgaaagcgaccctctgatcgacaaaaacatgatcattgacttttcgaaaaacctaaag
gagcgcagacaggtggggtttatgcaggtcctgtggccttctacctacaaagatgagccg
tga

DBGET integrated database retrieval system